Peptide Inhibitors

Need Assistance?

  • US & Canada:
    +
  • UK: +
Peptide Inhibitors

Amastatin hydrochloride

CAS 100938-10-1
Catalog BAT-015943
Molecular Weight 511.01
Molecular Formula C21H39ClN4O8
Sequence Unk-Val-Val-Asp-OH
Amastatin hydrochloride

Glutathione-monoisopropyl ester (reduced)

CAS 97451-46-2
Catalog BAT-015944
Molecular Weight 349.41
Molecular Formula C13H23N3O6S
Sequence H-gGlu-Cys-Gly-OiPr
Glutathione-monoisopropyl ester (reduced)

Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone

CAS 118253-05-7
Catalog BAT-015946
Molecular Weight 587.70
Molecular Formula C34H41N3O6
Sequence Cbz-Phe-Lys-Unk
Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone

4-Aminobenzoyl-Gly-Pro-D-Leu-D-Ala hydroxamic acid

CAS 124168-73-6
Catalog BAT-015947
Molecular Weight 490.55
Molecular Formula C23H34N6O6
Sequence H-4Abz-Gly-Pro-D-Leu-D-Ala-NHOH
4-Aminobenzoyl-Gly-Pro-D-Leu-D-Ala hydroxamic acid

Ac-DEVD-CHO

CAS 169332-60-9
Catalog BAT-015950
Molecular Weight 502.47
Molecular Formula C20H30N4O11
Sequence Ac-Asp-Glu-Val-Asp-al
Ac-DEVD-CHO

Cyclo(-Arg-Gly-Asp-D-Phe-Val)

CAS 137813-35-5
Catalog BAT-015959
Molecular Weight 574.63
Molecular Formula C26H38N8O7
Cyclo(-Arg-Gly-Asp-D-Phe-Val)

Z-Phe-Tyr(tBu)-diazomethylketone

CAS 114014-15-2
Catalog BAT-015967
Molecular Weight 542.63
Molecular Formula C31H34N4O5
Sequence Cbz-Phe-Tyr(tBu)-Unk
Z-Phe-Tyr(tBu)-diazomethylketone

Z-Ile-Glu(O-t-butyl)-Ala-Leucinal

CAS 158442-41-2
Catalog BAT-015968
Molecular Weight 618.76
Molecular Formula C32H50N4O8
Sequence Cbz-Ile-Glu(OtBu)-Ala-Leu-al
Z-Ile-Glu(O-t-butyl)-Ala-Leucinal

Galanin (1-13)-Neuropeptide Y (25-36) amide

CAS 147138-51-0
Catalog BAT-015971
Molecular Weight 2962.37
Molecular Formula C136H209N41O34
Sequence GWTLNSAGYLLGPRHYINLITRQRY
Galanin (1-13)-Neuropeptide Y (25-36) amide

Fmoc-Glu(Cys(Fmoc)-Gly-OH)-OH

CAS 149438-56-2
Catalog BAT-015972
Molecular Weight 751.80
Molecular Formula C40H37N3O10S
Sequence Fmoc-gGlu-Cys(Fmoc)-Gly-OH
Fmoc-Glu(Cys(Fmoc)-Gly-OH)-OH

CA 074

CAS 134448-10-5
Catalog BAT-015973
Molecular Weight 383.44
Molecular Formula C18H29N3O6
Sequence Unk-Ile-Pro-OH
CA 074

His-Cys-Lys-Phe-Trp-Trp

CAS 172546-75-7
Catalog BAT-015976
Molecular Weight 906.06
Molecular Formula C46H55N11O7S
Sequence HCKFWW
His-Cys-Lys-Phe-Trp-Trp

FTase Inhibitor II

CAS 156707-43-6
Catalog BAT-015977
Molecular Weight 371.47
Molecular Formula C15H21N3O4S2
Sequence H-Cys-4Abz-Met-OH
FTase Inhibitor II

Cathepsin L Inhibitor

CAS 167498-29-5
Catalog BAT-015978
Molecular Weight 446.49
Molecular Formula C26H26N2O5
Sequence Z-Phe-Tyr-CHO
Cathepsin L Inhibitor

Z-Val-Ala-DL-Asp(OMe)-fluoromethylketone

CAS 634911-81-2
Catalog BAT-015983
Molecular Weight 467.49
Molecular Formula C22H30FN3O7
Sequence Cbz-Val-Ala-DL-Asp(OMe)-CH2F
Z-Val-Ala-DL-Asp(OMe)-fluoromethylketone

EXENDIN-4 (3-39)

CAS 196109-31-6
Catalog BAT-015984
Molecular Weight 3992.44
Molecular Formula C176H272N46O58S
Sequence EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
EXENDIN-4 (3-39)

Sauvagine

CAS 74434-59-6
Catalog BAT-015989
Molecular Weight 4599.35
Molecular Formula C202H346N56O63S
Sequence XGPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI
Sauvagine

SHU 9119

CAS 168482-23-3
Catalog BAT-015990
Molecular Weight 1074.24
Molecular Formula C54H71N15O9
Sequence Ac-Nle-Asp(1)-His-D-2Nal-Arg-Trp-Lys(1)-NH2
SHU 9119

Endomorphin 1

CAS 189388-22-5
Catalog BAT-015992
Molecular Weight 610.7
Molecular Formula C34H38N6O5
Sequence H-Tyr-Pro-Trp-Phe-NH2
Endomorphin 1

GLP-2 (3-33)

CAS 275801-62-2
Catalog BAT-016009
Molecular Weight 3557.89
Molecular Formula C156H242N40O53S
Sequence DGSFSDEMNTILDNLAARDFINWLIQTKITD
GLP-2 (3-33)

Introduction of Peptide Inhibitors

Peptide inhibitors are a class of substances used to inhibit the biological function of peptides. Peptide inhibitors can be synthesized by acetylation, amidation, formylation, hydroxylation, lipid modification, methylation or phosphorylation of one or more amino acids in the target peptide sequence. Peptides inhibitors are widely used in food industry, cosmetics industry and medical research, and it could be expected that the importance of peptide inhibitors will increase with the manufacture of peptide inhibitors and the solution of performance problems.

Applications of Peptide Inhibitors

  1. Application in food industry
  2. Browning of vegetables and fruits will affect their appearance, smell and taste. The rate of enzymatic browning is determined by the concentration of activated tyrosinase and phenolic compounds in the tissue, available oxygen, pH value and temperature. Traditional browning inhibitors include ascorbic acid, citric acid and nitrite. Although the inhibition effect is excellent, it has serious side effects. The use of natural and harmless peptide inhibitors can achieve excellent inhibition of browning reaction without serious side effects.

  3. Application in cosmetics industry
  4. Many components of natural peptide inhibitors can be used as skin whitening agents. However, some components have the problems of reduction of skin immunity, carcinogenic risk, easy decomposition and strict transportation conditions. Therefore, by modifying the polypeptide sequence, the effective and safe polypeptide inhibitor with shorter polypeptide length can have safety, improve the water solubility and permeability of peptide precursors, avoid the decomposition of protease in the process of peptide precursors, and then maintain the concentration of drugs.

  5. Application in medical research
  6. Peptide inhibitors are widely used in research and medical practice. Peptides are mediators of biological functions. The unique intrinsic properties of peptides make peptides attractive therapeutic agents because of their relatively high biological activity, specificity and relatively low toxicity. However, peptides have disadvantages in vivo, such as relatively low stability, susceptibility to enzyme degradation, and relatively weak tumor penetration in cancer treatment. Peptide inhibitors synthesized by modifying natural peptides are feasible substitutes for other biological agents, and could be used in the fields of anti-tumor, anti-rheumatoid arthritis, anti-virus and so on.

Online Inquiry

Verification code
Inquiry Basket