Need Assistance?
  • US & Canada:
    +
  • UK: +

Acidocin B

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Acidocin B is an antimicrobial peptide produced by Lactobacillus acidophilus M46. It has antibacterial activity against Gram-positive and Gram-negative bacteria.

Category
Functional Peptides
Catalog number
BAT-013207
CAS number
155462-64-9
Synonyms
Acidocin B (Bacteriocin); acdB; Ile-Tyr-Trp-Ile-Ala-Asp-Gln-Phe-Gly-Ile-His-Leu-Ala-Thr-Gly-Thr-Ala-Arg-Lys-Leu-Leu-Asp-Ala-Val-Ala-Ser-Gly-Ala-Ser-Leu-Gly-Thr-Ala-Phe-Ala-Ala-Ile-Leu-Gly-Val-Thr-Leu-Pro-Ala-Trp-Ala-Leu-Ala-Ala-Ala-Gly-Ala-Leu-Gly-Ala-Thr-Ala-Ala
Purity
>98%
Sequence
IYWIADQFGIHLATGTARKLLDAVASGASLGTAFAAILGVTLPAWALAAAGALGATAA
1. Solution structure of acidocin B, a circular bacteriocin produced by Lactobacillus acidophilus M46
Jeella Z Acedo, Marco J van Belkum, Christopher T Lohans, Ryan T McKay, Mark Miskolzie, John C Vederas Appl Environ Microbiol. 2015 Apr;81(8):2910-8. doi: 10.1128/AEM.04265-14. Epub 2015 Feb 13.
Acidocin B, a bacteriocin produced by Lactobacillus acidophilus M46, was originally reported to be a linear peptide composed of 59 amino acid residues. However, its high sequence similarity to gassericin A, a circular bacteriocin from Lactobacillus gasseri LA39, suggested that acidocin B might be circular as well. Acidocin B was purified from culture supernatant by a series of hydrophobic interaction chromatographic steps. Its circular nature was ascertained by matrix-assisted laser desorption ionization-time of flight (MALDI-TOF) mass spectrometry and tandem mass spectrometry (MS/MS) sequencing. The peptide sequence was found to consist of 58 amino acids with a molecular mass of 5,621.5 Da. The sequence of the acidocin B biosynthetic gene cluster was also determined and showed high nucleotide sequence similarity to that of gassericin A. The nuclear magnetic resonance (NMR) solution structure of acidocin B in sodium dodecyl sulfate micelles was elucidated, revealing that it is composed of four α-helices of similar length that are folded to form a compact, globular bundle with a central pore. This is a three-dimensional structure for a member of subgroup II circular bacteriocins, which are classified based on their isoelectric points of ~7 or lower. Comparison of acidocin B with carnocyclin A, a subgroup I circular bacteriocin with four α-helices and a pI of 10, revealed differences in the overall folding. The observed variations could be attributed to inherent diversity in their physical properties, which also required the use of different solvent systems for three-dimensional structural elucidation.
2. DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221
A C Majhenic, K Venema, G E Allison, B B Matijasić, I Rogelj, T R Klaenhammer Appl Microbiol Biotechnol. 2004 Feb;63(6):705-14. doi: 10.1007/s00253-003-1424-2. Epub 2003 Sep 18.
Lactobacillus gasseri LF221, an isolate from the feces of a child, produces two bacteriocins. Standard procedures for molecular techniques were used to locate, clone and sequence the fragments of LF221 chromosomal DNA carrying the acidocin LF221 A and B structural genes, respectively. Sequencing analysis revealed the gene of acidocin LF221 A to be an open reading frame encoding a protein composed of 69 amino acids, including a 16-amino-acid N-terminal extension. The acidocin LF221 B gene was found to encode a 65-amino-acid bacteriocin precursor with a 17-amino-acid N-terminal leader peptide. DNA homology searches showed similarities of acidocin LF221 A to brochocin B, lactococcin N and thermophilin B, whereas acidocin LF221 B exhibited some homology to lactacin F and was virtually identical to gassericin X. The peptides encoded by orfA1 and orfB3 showed characteristics of class II bacteriocins and are suspected to be the complementary peptides of acidocin A and B, respectively. orfA3 and orfB5 are proposed to encode putative immunity proteins for the acidocins. Acidocin LF221 A and acidocin LF221 B are predicted to be members of the two-component class II bacteriocins, where acidocin LF221 A appears to be a novel bacteriocin. L. gasseri LF221 is being developed as a potential probiotic strain and a food/feed preservative. Detailed characterization of its acidocins is an important piece of background information useful in applying the strain into human or animal consumption. The genetic information on both acidocins also enables tracking of the LF221 strain in mixed populations and complex environments.
3. Genetic analysis of acidocin B, a novel bacteriocin produced by Lactobacillus acidophilus
R J Leer, J M van der Vossen, M van Giezen, J M van Noort, P H Pouwels Microbiology (Reading). 1995 Jul;141 ( Pt 7):1629-35. doi: 10.1099/13500872-141-7-1629.
The genes encoding the production of acidocin B, a bacteriocin produced by Lactobacillus acidophilus strain M46 which is active against Listeria monocytogenes, Clostridium sporogenes, Brochothrix thermosphacta, Lactobacillus fermentum and Lactobacillus delbrueckii subsp. bulgaricus, but inactive against most other Lactobacillus species, were previously localized on a 4 kb XbaI-HindIII fragment of plasmid pCV461. In the present work, DNA sequence analysis revealed the presence of three consecutive ORFs, which potentially code for hydrophobic peptides composed of 60, 91 and 114 amino acids, respectively, and a fourth ORF of opposite polarity which could potentially encode a peptide of 59 amino acids. The middle ORF (ORF-2; acdB) was identified as the gene encoding acidocin B by comparing the amino acid composition of highly purified acidocin B with the deduced amino acid sequence of ORF-2. Our results suggest that acidocin B is synthesized as a precursor which is processed at a site which conforms to the ' -3, -1' rules of von Heijne to yield active acidocin B (59 amino acids). The presence of an immunity-protein-encoding gene on the 4 kb XbaI-BamHI fragment was deduced from the capacity of a plasmid vector harbouring this fragment to confer immunity upon transformation of L. fermentum NCK127. One of the three non-assigned ORFs may encode this immunity protein.
Online Inquiry
Verification code
Inquiry Basket