Amyloid β-Protein (1-39)
Need Assistance?
  • US & Canada:
    +
  • UK: +

Amyloid β-Protein (1-39)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Category
Functional Peptides
Catalog number
BAT-014630
CAS number
115427-62-8
Molecular Formula
C189H286N52O57S
Molecular Weight
4230.73
IUPAC Name
(4S)-5-[[(1S)-2-[[(1S)-1-[[(1S)-2-[[(1S)-2-[[(1S)-2-[[2-[[(1S)-2-[[(1S)-1-[[(1S)-1-[[(1S)-2-[[(1S)-2-[[(1S)-4-amino-1-[[(1S)-5-amino-1-[[(1S)-1-[[(1S)-1-[[(1S)-2-[[(1S)-2-[[(1S)-2-[[(1S)-1-[[(1S)-2-[[(1S)-1-[[2-[[(1S)-2-[[(1S)-3-amino-1-[[(1S)-5-amino-1-[[2-[[(1S)-2-[[(1S,2S)-1-[[(1S,2S)-1-[[2-[[(1S)-1-[[(1S)-1-[[(1S)-1-[[2-[[2-[[(1S)-1-carboxy-2-methyl-propyl]amino]-2-oxo-ethyl]amino]-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamoyl]-3-methylsulfanyl-propyl]carbamoyl]-3-methyl-butyl]amino]-2-oxo-ethyl]carbamoyl]-2-methyl-butyl]carbamoyl]-2-methyl-butyl]amino]-1-methyl-2-oxo-ethyl]amino]-2-oxo-ethyl]carbamoyl]pentyl]carbamoyl]-3-oxo-propyl]amino]-1-(hydroxymethyl)-2-oxo-ethyl]amino]-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]amino]-1-(carboxymethyl)-2-oxo-ethyl]carbamoyl]-3-carboxy-propyl]amino]-1-methyl-2-oxo-ethyl]amino]-1-benzyl-2-oxo-ethyl]amino]-1-benzyl-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamoyl]-3-methyl-butyl]carbamoyl]pentyl]carbamoyl]-4-oxo-butyl]amino]-1-(1H-imidazol-4-ylmethyl)-2-oxo-ethyl]amino]-1-(1H-imidazol-4-ylmethyl)-2-oxo-ethyl]carbamoyl]-2-methyl-propyl]carbamoyl]-3-carboxy-propyl]amino]-1-[(4-hydroxyphenyl)methyl]-2-oxo-ethyl]amino]-2-oxo-ethyl]amino]-1-(hydroxymethyl)-2-oxo-ethyl]amino]-1-(carboxymethyl)-2-oxo-ethyl]amino]-1-(1H-imidazol-4-ylmethyl)-2-oxo-ethyl]carbamoyl]-4-guanidino-butyl]amino]-1-benzyl-2-oxo-ethyl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-carboxy-propanoyl]amino]propanoyl]amino]-5-oxo-pentanoic acid
Synonyms
H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-OH
Appearance
White Powder
Purity
≥95%
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Storage
Store at -20°C
Solubility
Soluble in Acetonitrile, DMSO, Water
InChI
InChI=1S/C189H286N52O57S/c1-23-99(17)154(184(293)206-85-140(250)213-121(65-92(3)4)170(279)223-120(60-64-299-22)168(277)236-149(94(7)8)182(291)204-81-137(247)201-82-142(252)235-153(98(15)16)188(297)298)241-187(296)155(100(18)24-2)240-158(267)101(19)210-138(248)83-202-160(269)113(45-34-36-61-190)218-177(286)130(75-136(194)246)229-181(290)134(88-243)215-141(251)86-205-183(292)150(95(9)10)237-180(289)132(77-148(263)264)230-166(275)118(54-58-144(255)256)217-157(266)103(21)212-169(278)124(67-104-39-28-25-29-40-104)226-173(282)126(69-106-43-32-27-33-44-106)232-185(294)152(97(13)14)239-179(288)122(66-93(5)6)224-162(271)114(46-35-37-62-191)219-164(273)116(52-56-135(193)245)221-174(283)127(71-108-78-197-89-207-108)228-176(285)129(73-110-80-199-91-209-110)233-186(295)151(96(11)12)238-167(276)119(55-59-145(257)258)222-171(280)123(70-107-48-50-111(244)51-49-107)214-139(249)84-203-161(270)133(87-242)234-178(287)131(76-147(261)262)231-175(284)128(72-109-79-198-90-208-109)227-163(272)115(47-38-63-200-189(195)196)220-172(281)125(68-105-41-30-26-31-42-105)225-165(274)117(53-57-143(253)254)216-156(265)102(20)211-159(268)112(192)74-146(259)260/h25-33,39-44,48-51,78-80,89-103,112-134,149-155,242-244H,23-24,34-38,45-47,52-77,81-88,190-192H2,1-22H3,(H2,193,245)(H2,194,246)(H,197,207)(H,198,208)(H,199,209)(H,201,247)(H,202,269)(H,203,270)(H,204,291)(H,205,292)(H,206,293)(H,210,248)(H,211,268)(H,212,278)(H,213,250)(H,214,249)(H,215,251)(H,216,265)(H,217,266)(H,218,286)(H,219,273)(H,220,281)(H,221,283)(H,222,280)(H,223,279)(H,224,271)(H,225,274)(H,226,282)(H,227,272)(H,228,285)(H,229,290)(H,230,275)(H,231,284)(H,232,294)(H,233,295)(H,234,287)(H,235,252)(H,236,277)(H,237,289)(H,238,276)(H,239,288)(H,240,267)(H,241,296)(H,253,254)(H,255,256)(H,257,258)(H,259,260)(H,261,262)(H,263,264)(H,297,298)(H4,195,196,200)/t99-,100-,101-,102-,103-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,149-,150-,151-,152-,153-,154-,155-/m0/s1
InChI Key
ZIZSPTDSSIONIO-FKGJHEENSA-N
1. Association of Plasma p-tau181 and p-tau231 Concentrations With Cognitive Decline in Patients With Probable Dementia With Lewy Bodies
Maria C Gonzalez, et al. JAMA Neurol. 2022 Jan 1;79(1):32-37. doi: 10.1001/jamaneurol.2021.4222.
Importance: Plasma phosphorylated tau (p-tau) has proven to be an accurate biomarker for Alzheimer disease (AD) pathologic characteristics, offering a less expensive and less invasive alternative to cerebrospinal fluid (CSF) and positron emission tomography biomarkers for amyloid-β and tau. Alzheimer disease comorbid pathologic characteristics are common and are associated with more rapid cognitive decline in patients with dementia with Lewy bodies (DLB); therefore, it is anticipated that plasma p-tau concentrations may have utility in assessing cognitive impairment in individuals with this disorder. Objective: To measure the concentrations of plasma p-tau (p-tau181 and p-tau231) and evaluate their associations with cognitive decline in individuals with probable DLB. Design, setting, and participants: This multicenter longitudinal cohort study included participants from the European-DLB (E-DLB) Consortium cohort enrolled at 10 centers with harmonized diagnostic procedures from January 1, 2002, to December 31, 2020, with up to 5 years of follow-up. A total of 1122 participants with plasma samples were available. Participants with acute delirium or terminal illness and patients with other previous major psychiatric or neurologic disorders were excluded, leaving a cohort of 987 clinically diagnosed participants with probable DLB (n = 371), Parkinson disease (n = 204), AD (n = 207), as well as healthy controls (HCs) (n = 205). Main outcomes and measures: The main outcome was plasma p-tau181 and p-tau231 levels measured with in-house single molecule array assays. The Mini-Mental State Examination (MMSE) was used to measure cognition. Results: Among this cohort of 987 patients (512 men [51.9%]; mean [SD] age, 70.0 [8.8] years), patients with DLB did not differ significantly regarding age, sex, or years of education from those in the AD group, but the DLB group was older than the HC group and included more men than the AD and HC groups. Baseline concentrations of plasma p-tau181 and p-tau231 in patients with DLB were significantly higher than those in the HC group but lower than in the AD group and similar to the Parkinson disease group. Higher plasma concentrations of both p-tau markers were found in a subgroup of patients with DLB with abnormal CSF amyloid-β42 levels compared with those with normal levels (difference in the groups in p-tau181, -3.61 pg/mL; 95% CI, -5.43 to -1.79 pg/mL; P = .049; difference in the groups in p-tau231, -2.51 pg/mL; 95% CI, -3.63 to -1.39 pg/mL; P = .02).
2. The C-terminus of the beta protein is critical in amyloidogenesis
J T Jarrett, E P Berger, P T Lansbury Jr Ann N Y Acad Sci. 1993 Sep 24;695:144-8. doi: 10.1111/j.1749-6632.1993.tb23043.x.
The beta amyloid protein found in extracellular deposits in Alzheimer's disease (AD) is heterogeneous at its C-terminus; proteins ending at residues 40, 42, and 43 have been identified in neuritic deposits, while protein in vascular amyloid appears to end at residue 39 or 40. Studies of synthetic beta proteins (beta 1-39, beta 1-40, beta 1-42), and model peptides (beta 26-39, beta 26-40, beta 26-42, beta 26-43) demonstrate that amyloid formation is a nucleation-dependent phenomenon. Peptides ending at residues 39 or 40 were kinetically soluble for hours to days, while peptides ending at residues 42 or 43 aggregated immediately; all eventually reached similar thermodynamic solubility. The kinetically soluble variants could be seeded with the kinetically insoluble variants. The secondary structure of beta 26-39 fibrils was different from that of beta 26-42 fibrils, however, seeding beta 26-39 with beta 26-42 produces mixed fibrils with structure similar to beta 26-42. These results suggest that neuritic plaques may be seeded by their minor component; this may determine the structure and properties of amyloid in AD.
3. Prospective biomarkers of Alzheimer's disease: A systematic review and meta-analysis
Rui-Xian Li, Ya-Hui Ma, Lan Tan, Jin-Tai Yu Ageing Res Rev. 2022 Nov;81:101699. doi: 10.1016/j.arr.2022.101699. Epub 2022 Jul 26.
Objective: Alzheimer's disease (AD) involves a series of pathological changes and some biomarkers were reported to assist in monitoring and predicting disease progression before the emergence of clinical symptoms. We aimed to identify prospective biomarkers and quantify their effect on AD progression. Methods: PubMed, EMBASE and Web of Science databases were searched for prospective cohort studies published up to October 2021. Eligible studies were included, and the available data were extracted. Meta-analyses were conducted based on random-effect models. Relative risk (RR) with 95% confidence interval (CI) was adopted as the final effect size. Results: Totally 48,769 articles were identified, of which 84 studies with 20 prospective biomarkers were included in meta-analyses. In the present study, 15 biomarkers were associated with AD progression, comprising CSF Aβ42 (RR=2.49, 95%CI=1.68-3.69), t-tau (RR=1.88, 95%CI=1.49-2.37), p-tau (RR=1.74, 95%CI=1.37-2.21), tau/Aβ42 ratio (RR=5.11, 95%CI=2.01-13.00); peripheral blood Aβ42/Aβ40 (RR=1.26, 95%CI=1.05-1.51), t-tau (RR=1.33, 95%CI=1.08-1.64), NFL (RR=1.75, 95%CI=1.07-2.87); whole, left and right hippocampal volume (HV) (whole: RR=1.65, 95%CI=1.39-1.95; left: RR=2.60, 95%CI=1.02-6.64; right: RR=1.43, 95%CI=1.23-1.66), entorhinal cortex (EC) volume (RR=1.69, 95%CI=1.24-2.30), medial temporal lobe atrophy (MTA) (RR=1.52, 95%CI=1.33-1.74), 18 F-FDG PET (RR=2.24, 95%CI=1.29-3.89), 11 C-labeled Pittsburgh Compound B PET (11 C-PIB PET) (RR=3.91, 95%CI=1.06-14.41); APOE ε4 (RR=2.16, 1.83-2.55). A total of 70 articles were included in the qualitative review, in which 61 biomarkers were additionally associated with AD progression. Conclusion: CSF Aβ42, t-tau, p-tau, tau/Aβ42; peripheral blood t-tau, Aβ42/Aβ40, NFL; whole, left and right HV, EC volume, MTA, 18 F-FDG PET, 11 C-PIB PET; APOE ε4 may be promising prospective biomarkers for AD progression.
Online Inquiry
Verification code
Inquiry Basket