webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Andersonin-A peptide precursor
Need Assistance?
  • US & Canada:
    +
  • UK: +

Andersonin-A peptide precursor

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Andersonin-A peptide precursor is an antimicrobial peptide produced by Odorrana andersonii (golden crossband frog). It has antimicrobial activity.

Category
Functional Peptides
Catalog number
BAT-013256
Synonyms
Pro-Leu-Lys-Lys-Ser-Leu-Leu-Leu-Leu-Phe-Phe-Phe-Gly-Thr-Ile-Asn-Leu-Ser-Leu-Cys-Gln-Asp-Glu-Thr-Asn-Pro-Glu-Glu-Lys-Lys-Arg-Asp-Glu-Glu-Val-Ala-Lys-Met-Glu-Glu
Appearance
Powder
Purity
>97%
Sequence
PLKKSLLLLFFFGTINLSLCQDETNPEEKKRDEEVAKMEE
Storage
Store at -20°C
1. Peptidome: Chaos or Inevitability
Irina Lyapina, Vadim Ivanov, Igor Fesenko Int J Mol Sci. 2021 Dec 4;22(23):13128. doi: 10.3390/ijms222313128.
Thousands of naturally occurring peptides differing in their origin, abundance and possible functions have been identified in the tissue and biological fluids of vertebrates, insects, fungi, plants and bacteria. These peptide pools are referred to as intracellular or extracellular peptidomes, and besides a small proportion of well-characterized peptide hormones and defense peptides, are poorly characterized. However, a growing body of evidence suggests that unknown bioactive peptides are hidden in the peptidomes of different organisms. In this review, we present a comprehensive overview of the mechanisms of generation and properties of peptidomes across different organisms. Based on their origin, we propose three large peptide groups-functional protein "degradome", small open reading frame (smORF)-encoded peptides (smORFome) and specific precursor-derived peptides. The composition of peptide pools identified by mass-spectrometry analysis in human cells, plants, yeast and bacteria is compared and discussed. The functions of different peptide groups, for example the role of the "degradome" in promoting defense signaling, are also considered.
2. Evolutionary origins of a bioactive peptide buried within Preproalbumin
Alysha G Elliott, et al. Plant Cell. 2014 Mar;26(3):981-95. doi: 10.1105/tpc.114.123620. Epub 2014 Mar 28.
The de novo evolution of proteins is now considered a frequented route for biological innovation, but the genetic and biochemical processes that lead to each newly created protein are often poorly documented. The common sunflower (Helianthus annuus) contains the unusual gene PawS1 (Preproalbumin with SFTI-1) that encodes a precursor for seed storage albumin; however, in a region usually discarded during albumin maturation, its sequence is matured into SFTI-1, a protease-inhibiting cyclic peptide with a motif homologous to unrelated inhibitors from legumes, cereals, and frogs. To understand how PawS1 acquired this additional peptide with novel biochemical functionality, we cloned PawS1 genes and showed that this dual destiny is over 18 million years old. This new family of mostly backbone-cyclic peptides is structurally diverse, but the protease-inhibitory motif was restricted to peptides from sunflower and close relatives from its subtribe. We describe a widely distributed, potential evolutionary intermediate PawS-Like1 (PawL1), which is matured into storage albumin, but makes no stable peptide despite possessing residues essential for processing and cyclization from within PawS1. Using sequences we cloned, we retrodict the likely stepwise creation of PawS1's additional destiny within a simple albumin precursor. We propose that relaxed selection enabled SFTI-1 to evolve its inhibitor function by converging upon a successful sequence and structure.
3. BACE1 (β-secretase) inhibitors for the treatment of Alzheimer's disease
Arun K Ghosh, Heather L Osswald Chem Soc Rev. 2014 Oct 7;43(19):6765-813. doi: 10.1039/c3cs60460h.
BACE1 (β-secretase, memapsin 2, Asp2) has emerged as a promising target for the treatment of Alzheimer's disease. BACE1 is an aspartic protease which functions in the first step of the pathway leading to the production and deposition of amyloid-β peptide (Aβ). Its gene deletion showed only mild phenotypes. BACE1 inhibition has direct implications in the Alzheimer's disease pathology without largely affecting viability. However, inhibiting BACE1 selectively in vivo has presented many challenges to medicinal chemists. Since its identification in 2000, inhibitors covering many different structural classes have been designed and developed. These inhibitors can be largely classified as either peptidomimetic or non-peptidic inhibitors. Progress in these fields resulted in inhibitors that contain many targeted drug-like characteristics. In this review, we describe structure-based design strategies and evolution of a wide range of BACE1 inhibitors including compounds that have been shown to reduce brain Aβ, rescue the cognitive decline in transgenic AD mice and inhibitor drug candidates that are currently in clinical trials.
Online Inquiry
Inquiry Basket