Bacteriocin leucocin-A
Need Assistance?
  • US & Canada:
    +1-844-BOC(262)-0123
  • UK: +44-20-3286-1088

Bacteriocin leucocin-A

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Bacteriocin leucocin-A is an antimicrobial peptide produced by Leuconostoc gelidum UAL187. It has antibacterial activity against Gram-positive bacteria: Lactic acid bacteria, Listeria monocytogenes.

Category
Functional Peptides
Catalog number
BAT-013005
CAS number
139069-78-6
Molecular Formula
C174H246N52O50S2
Molecular Weight
3930.32
IUPAC Name
(2S,5S,11S,20S,23S,26S,29S,32S,35S,41S,44S,47S,50S,53S)-32-((1H-imidazol-4-yl)methyl)-53-((3S,6S,9S,12S)-1-((4R,10S,13S,16S,19R)-19-((2S,5S,11S,17S,20S,23S)-2-((1H-imidazol-4-yl)methyl)-23,27-diamino-11-(2-amino-2-oxoethyl)-17,20-bis(4-hydroxybenzyl)-5-isopropyl-4,7,10,13,16,19,22-heptaoxo-3,6,9,12,15,18,21-heptaazaheptacosanamido)-13-(4-aminobutyl)-16-((R)-1-hydroxyethyl)-10-(hydroxymethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-4-yl)-12-((1H-indol-3-yl)methyl)-9-(2-amino-2-oxoethyl)-3-(hydroxymethyl)-6-isopropyl-1,4,7,10,13-pentaoxo-2,5,8,11,14-pentaazahexadecan-16-amido)-2-((1H-indol-3-yl)methyl)-11,20-bis(2-amino-2-oxoethyl)-5,47-dibenzyl-29-(3-guanidinopropyl)-44-(hydroxymethyl)-26-isobutyl-35-isopropyl-23,41,50-trimethyl-4,7,10,13,16,19,22,25,28,31,34,37,40,43,46,49,52-heptadecaoxo-3,6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51-heptadecaazahexapentacontanedioic acid
Synonyms
lcnA; Leucocin A-UAL 187; Leu A; Leucocin-A; Leucocin A-TA33a; Leucocin A-QU15; Lys-Tyr-Tyr-Gly-Asn-Gly-Val-His-Cys-Thr-Lys-Ser-Gly-Cys-Ser-Val-Asn-Trp-Gly-Glu-Ala-Phe-Ser-Ala-Gly-Val-His-Arg-Leu-Ala-Asn-Gly-Gly-Asn-Gly-Phe-Trp (Disulfide bridge: Cys9-Cys14)
Appearance
Lyophilized Powder or Liquid
Purity
>85%
Sequence
KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW (Disulfide bridge: Cys9-Cys14)
Storage
Store at -20°C
1. Genetic characterisation and heterologous expression of leucocin C, a class IIa bacteriocin from Leuconostoc carnosum 4010
Xing Wan, Ruiqing Li, Per E J Saris, Timo M Takala Appl Microbiol Biotechnol. 2013 Apr;97(8):3509-18. doi: 10.1007/s00253-012-4406-4. Epub 2012 Oct 9.
Leuconostoc carnosum 4010 is a protective culture for meat products. It kills the foodborne pathogen Listeria monocytogenes by producing two class IIa (pediocin-like) bacteriocins, leucocin A and leucocin C. The genes for leucocin A production have previously been characterised from Leuconostoc gelidum UAL 187, whereas no genetic studies about leucocin C has been published. Here, we characterised the genes for the production of leucocins A and C in L. carnosum 4010. In this strain, leucocin A and leucocin C operons were localised in different plasmids. Unlike in L. gelidum, leucocin A operon in L. carnosum 4010 only contained the structural and the immunity genes lcaAB without transporter genes lcaECD. On the contrary, leucocin C cluster included two intact operons. Novel genes lecCI encode the leucocin C precursor and the 97-aa immunity protein LecI, respectively. LecI shares 48 % homology with the immunity proteins of sakacin P and listeriocin. Another leucocin C operon lecXTS, encoding an ABC transporter and an accessory protein, was 97 % identical with the leucocin A transporter operon lcaECD of L. gelidum. For heterologous expression of leucocin C in Lactococcus lactis, the mature part of the lecC gene was fused with the signal sequence of usp45 in the secretion vector pLEB690. L. lactis secreted leucocin C efficiently, as shown by large halos on lawns of L. monocytogenes and Leuconostoc mesenteroides indicators. The function of LecI was then demonstrated by expressing the gene lecI in L. monocytogenes. LecI-producing Listeria was less sensitive to leucocin C than the vector strain, thus corroborating the immunity function of LecI.
2. Characterization of leucocin A-UAL 187 and cloning of the bacteriocin gene from Leuconostoc gelidum
J W Hastings, M Sailer, K Johnson, K L Roy, J C Vederas, M E Stiles J Bacteriol. 1991 Dec;173(23):7491-500. doi: 10.1128/jb.173.23.7491-7500.1991.
Leucocin A-UAL 187 is a bacteriocin produced by Leuconostoc gelidum UAL 187, a lactic acid bacterium isolated from vacuum-packaged meat. The bacteriocin was purified by ammonium sulfate or acid (pH 2.5) precipitation, hydrophobic interaction chromatography, gel filtration, and reversed-phase high-performance liquid chromatography with a yield of 58% of the original activity. Leucocin A is stable at low pH and heat resistant, and the activity of the pure form is enhanced by the addition of bovine serum albumin. It is inactivated by a range of proteolytic enzymes. The molecular weight was determined by mass spectrometry to be 3,930.3 +/- 0.4. Leucocin A-UAL 187 contains 37 amino acids with a calculated molecular weight of 3,932.3. A mixed oligonucleotide (24-mer) homologous to the sequence of the already known N terminus of the bacteriocin hybridized to a 2.9-kb HpaII fragment of a 7.6-MDa plasmid from the producer strain. The fragment was cloned into pUC118 and then subcloned into a lactococcal shuttle vector, pNZ19. DNA sequencing revealed an operon consisting of a putative upstream promoter, a downstream terminator, and two open reading frames flanked by a putative upstream promoter and a downstream terminator. The first open reading frame downstream of the promoter contains 61 amino acids and is identified as the leucocin structural gene, consisting of a 37-amino-acid bacteriocin and a 24-residue N-terminal extension. No phenotypic expression of the bacteriocin was evident in several lactic acid bacteria that were electrotransformed with pNZ19 containing the 2.9-kb cloned fragment of the leucocin A plasmid.
3. Characterization of leucocin B-Ta11a: a bacteriocin from Leuconostoc carnosum Ta11a isolated from meat
J V Felix, M A Papathanasopoulos, A A Smith, A von Holy, J W Hastings Curr Microbiol. 1994 Oct;29(4):207-12. doi: 10.1007/BF01570155.
Leuconostoc (Lc.) carnosum Ta11a, isolated from vacuum-packaged processed meats, produced a bacteriocin designated leucocin B-Ta11a. The crude bacteriocin was heat stable and sensitive to proteolytic enzymes, but not to catalase, lysozyme, or chloroform. It was active against Listeria monocytogenes and several lactic acid bacteria. Leucocin B-Ta11a was optimally produced at 25 degrees C in MRS broth at an initial pH of 6.0 or 6.5. An 8.9-MDa plasmid in Leuconostoc carnosum Ta11a hybridized to a 36-mer oligonucleotide probe (JF-1) that was homologous to leucocin A-UAL187. A 4.9-kb Sau3A fragment from a partial digest of the 8.9-MDa plasmid was cloned into pUC118. The 8.1-kb recombinant plasmid (pJF8.1) was used for sequencing and revealed the presence of two open reading frames (ORFs). ORF1 codes for a protein of 61 amino acids comprising a 37-amino-acid bacteriocin that was determined to be the leucocin B-Ta11a structural gene by virtue of its homology to leucocin A-UAL 187 (Hastings et al. 1991. J. Bacteriol 173:7491-7500). The 24-amino-acid N-terminal extension, however, differs from that of leucocin A-UAL187 by seven residues. The predicted protein of the ORF2 has 113 amino acids and is identical with the amino acid sequence of the cognate ORF of the leucocin A-UAL 187 operon.
Online Inquiry
0
Inquiry Basket

No data available, please add!

Delete selectedGo to checkout

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

x