Need Assistance?
  • US & Canada:
    +
  • UK: +

Beta defensin

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Beta defensin is an antimicrobial peptide produced by Capra hircus. It has antimicrobial activity.

Category
Functional Peptides
Catalog number
BAT-013025
Synonyms
Asn-His-Arg-Ser-Cys-His-Arg-Ile-Lys-Gly-Val-Cys-Ala-Pro-Asp-Arg-Cys-Pro-Arg-Asn-Met-Arg-Gln-Ile-Gly-Thr-Cys-Phe-Gly-Pro-Pro-Val-Lys-Cys-Cys-Arg
Purity
>98%
Sequence
NHRSCHRIKGVCAPDRCPRNMRQIGTCFGPPVKCCR
1. β-Defensin: An adroit saviour in teleosts
Sweta Das, Chiranjiv Pradhan, Devika Pillai Fish Shellfish Immunol. 2022 Apr;123:417-430. doi: 10.1016/j.fsi.2022.03.017. Epub 2022 Mar 22.
β-Defensin (BD) is an important first line innate defense molecule with potent antimicrobial and immunomodulatory activities in fish. The signatures of β-defensins are the presence of a net cationic charge and three intramolecular disulfide bonds mediated by six conserved cysteines. It consists of three exons and two introns. The signal peptide is usually conserved and sequence divergence is mostly seen in mature peptide region. The diverse amino acid sequences of matured peptide contribute to a strong positive selection and broad-spectrum antimicrobial activity. It is constitutively expressed in both mucosal as well as systemic sites. Increased expression of β-defensin was mostly reported in bacterial and viral infections in fish. Its role during parasitic and fungal infections is yet to be investigated. β-Defensin isoforms such as BD-1, BD-2, BD-3, BD-4 and BD-5 can be witnessed even in early developmental days to different pathogenic exposure in fish. β-Defensins possess adjuvant properties to enhance antigen-specific immunity promoting both cellular and humoral immune response. It significantly reduces/increases bacterial colonization or viral copy numbers when overexpressed/knockdown. Based on its chemotactic and activating potentials, it can contribute to both innate and adaptive immune responses. With mediated expression, it can also control inflammation. It is potent governing resistance in early developmental days as well. Its expression in pituitary and testis suggests its participation in reproduction and endocrine regulation in fish. Overall, β-defensins is an important member of antimicrobial peptides (AMPs) with multifunctional role in general homeostasis and to pathogen exposure possessing tremendous therapeutic approaches.
2. Human β-defensin-3 attenuates atopic dermatitis-like inflammation through autophagy activation and the aryl hydrocarbon receptor signaling pathway
Ge Peng, et al. J Clin Invest. 2022 Sep 1;132(17):e156501. doi: 10.1172/JCI156501.
Human β-defensin-3 (hBD-3) exhibits antimicrobial and immunomodulatory activities; however, its contribution to autophagy regulation remains unclear, and the role of autophagy in the regulation of the epidermal barrier in atopic dermatitis (AD) is poorly understood. Here, keratinocyte autophagy was restrained in the skin lesions of patients with AD and murine models of AD. Interestingly, hBD-3 alleviated the IL-4- and IL-13-mediated impairment of the tight junction (TJ) barrier through keratinocyte autophagy activation, which involved aryl hydrocarbon receptor (AhR) signaling. While autophagy deficiency impaired the epidermal barrier and exacerbated inflammation, hBD-3 attenuated skin inflammation and enhanced the TJ barrier in AD. Importantly, hBD-3-mediated improvement of the TJ barrier was abolished in autophagy-deficient AD mice and in AhR-suppressed AD mice, suggesting a role for hBD-3-mediated autophagy in the regulation of the epidermal barrier and inflammation in AD. Thus, autophagy contributes to the pathogenesis of AD, and hBD-3 could be used for therapeutic purposes.
3. Human β-Defensin 2 and Its Postulated Role in Modulation of the Immune Response
Martyna Cieślik, Natalia Bagińska, Andrzej Górski, Ewa Jończyk-Matysiak Cells. 2021 Nov 3;10(11):2991. doi: 10.3390/cells10112991.
Studies described so far suggest that human β-defensin 2 is an important protein of innate immune response which provides protection for the human organism against invading pathogens of bacterial, viral, fungal, as well as parasitical origin. Its pivotal role in enhancing immunity was proved in infants. It may also be considered a marker of inflammation. Its therapeutic administration has been suggested for maintenance of the balance of systemic homeostasis based on the appropriate composition of the microbiota. It has been suggested that it may be an important therapeutic tool for modulating the response of the immune system in many inflammatory diseases, offering new treatment modalities. For this reason, its properties and role in the human body discussed in this review should be studied in more detail.
Online Inquiry
Inquiry Basket