Beta-defensin 9 (Bos taurus)
Need Assistance?
  • US & Canada:
    +
  • UK: +

Beta-defensin 9 (Bos taurus)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Beta-defensin 9 is an antibacterial peptide isolated from Bos taurus.

Category
Functional Peptides
Catalog number
BAT-013710
Synonyms
BNBD-9
Sequence
EGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR
1. Associations between Bovine β-Defensin 4 Genotypes and Production Traits of Polish Holstein-Friesian Dairy Cattle
Paulina Brodowska, Lech Zwierzchowski, Sylwester Marczak, Wiesław Jarmuż, Emilia Bagnicka Animals (Basel). 2019 Sep 25;9(10):723. doi: 10.3390/ani9100723.
This study analyzed the associations between two single-nucleotide polymorphisms (C2239T and A1674C), used together as a genotype located in BNBD4, and milk traits and breeding values of productivity traits of Polish Holstein-Friesian dairy cows. The research was carried out on 322 cows, with 7070 milk parameter and somatic cell count records in daily milking, as well as 897 records covering data on whole lactations, and 2209 breeding value records for productivity traits. The DMU statistical package with a one-trait repeatability test-day animal model was used to estimate the associations. The differences between the genotype effects were analyzed using Duncan's post-hoc tests. The CC/AA and CT/AC genotypes had the highest frequencies (0.62 and 0.23, respectively). For use in marker-assisted selection, the CC/AC genotype is the most promising as an indicator of high-yielding cows potentially resistant to mastitis, because it was associated with the lowest somatic cell count (SCC), highest milk, fat, and protein yields in daily milking, as well as with milk yield in the whole lactation. The studied genotypes were also related to the breeding values of all the investigated production traits. However, some simulation studies have indicated a high rate of false-positives in GWAS based on classically calculated EBVs.
2. The synthetic peptides bovine enteric β-defensin (EBD), bovine neutrophil β-defensin (BNBD) 9 and BNBD 3 are chemotactic for immature bovine dendritic cells
Sarah Mackenzie-Dyck, Sam Attah-Poku, Veronique Juillard, Lorne A Babiuk, Sylvia van Drunen Littel-van den Hurk Vet Immunol Immunopathol. 2011 Sep 15;143(1-2):87-107. doi: 10.1016/j.vetimm.2011.06.028. Epub 2011 Jun 24.
Human and murine immature DCs (iDCs) are highly efficient in antigen capture and processing, while as mature cells they present antigen and are potent initiators of cell-mediated immune responses. Consequently, iDCs are logical targets for vaccine antigens. Originally discovered for their antimicrobial activity, and thought of as strictly part of the innate immune system, studies with defensins such as human β (beta)-defensin 2 (hBD2) and murine β-defensin 2 (mBD2) have shown that they can function as chemo-attractant for iDCs and, in vaccination strategies, can enhance antigen-specific adaptive immune responses. Most studies to date have been conducted in mice. In contrast, little is known about defensins in cattle. To expand our understanding of the role of defensins in modulating immune responses in cattle, DCs were generated from bovine monocytes and the immature state of these bovine DCs was characterized phenotypically and through functional assays. By day 3 (DC3), bovine monocyte-derived DCs stained positively for DC-specific receptors CD1, CD80/86, CD205, DC-Lamp and MMR. When compared to conventional 6-day DC cultures or DCs cultured for 10 days with and without maturation factors, these DC3 were functionally at their most immature stage. Fourteen of the 16 known bovine β-defensins were synthesized and the synthetic peptides were screened for their ability to attract bovine iDCs. Bovine DC3 were consistently attracted to BNBD3, an analog of BNBD3 (aBNBD3), BNBD9 and bovine EBD in vitro and to aBNBD3 in vivo. These results are the first to describe chemotactic ability of synthetic bovine β-defensins for immature bovine monocyte-derived DCs.
3. Investigation of serum beta-defensin-1 levels in bovine trichophytosis cases
Aynur Simsek Vet World. 2021 Sep;14(9):2508-2511. doi: 10.14202/vetworld.2021.2508-2511. Epub 2021 Sep 24.
Background and aim: Antimicrobial peptides are polypeptides that are a component of innate immunity and exhibit antifungal activity. This study aimed to investigate serum beta-defensin-1 levels in cattle diagnosed with trichophytosis, which is a zoonotic skin disease that affects several animal species. Materials and methods: A total of 23 young cattle, aged 2-4 months, of different breeds and sexes were selected. Of these, 16 cattle were clinically diagnosed with trichophytosis and seven were healthy. Results: The mean serum beta-defensin-1 levels of the infected animals were lower than those of control animals, yet the difference between the two groups was not significant (p>0.05). Conclusion: No significant alterations occurred in serum beta-defensin-1 levels of cattle with trichophytosis.
Online Inquiry
Inquiry Basket