CART (61-102) (human, rat)
Need Assistance?
  • US & Canada:
    +
  • UK: +

CART (61-102) (human, rat)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

CART (61-102) (human, rat) is a peptide derived from the Cocaine- and Amphetamine-Regulated Transcript (CART) protein, used in the research of metabolic disorders, obesity and their associated afflictions.

Category
Peptide Inhibitors
Catalog number
BAT-015139
CAS number
209615-75-8
Molecular Formula
C189H310N58O56S7
Molecular Weight
4515.36
Synonyms
CART (48-89) (human); H-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bridge: Cys8-Cys26, Cys14-Cys34, Cys28-Cys41); Cocaine- and amphetamine-regulated transcript fragment 61-102
Appearance
White or Off-white Lyophilized Powder
Purity
95%
Sequence
KYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: Cys8-Cys26, Cys14-Cys34, Cys28-Cys41)
Storage
Store at -20°C
Solubility
Soluble in DMSO, Water
1.New analogs of the CART peptide with anorexigenic potency: the importance of individual disulfide bridges.
Blechová M1, Nagelová V, Záková L, Demianová Z, Zelezná B, Maletínská L. Peptides. 2013 Jan;39:138-44. doi: 10.1016/j.peptides.2012.09.033. Epub 2012 Nov 19.
The CART (cocaine- and amphetamine-regulated transcript) peptide is an anorexigenic neuropeptide that acts in the hypothalamus. The receptor and the mechanism of action of this peptide are still unknown. In our previous study, we showed that the CART peptide binds specifically to PC12 rat pheochromocytoma cells in both the native and differentiated into neuronal phenotype. Two biologically active forms, CART(55-102) and CART(61-102), with equal biological activity, contain three disulfide bridges. To clarify the importance of each of these disulfide bridges in maintaining the biological activity of CART(61-102), an Ala scan at particular S-S bridges forming cysteines was performed, and analogs with only one or two disulfide bridges were synthesized. In this study, a stabilized CART(61-102) analog with norleucine instead of methionine at position 67 was also prepared and was found to bind to PC12 cells with an anorexigenic potency similar to that of CART(61-102).
Online Inquiry
Inquiry Basket