Need Assistance?

US & Canada:
+
UK: +

FAQs

Resources

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

Application Area

β-CGRP, human

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

β-CGRP, human is a highly effective vasodilator.

Category

Peptide APIs

Catalog number

BAT-010181

CAS number

101462-82-2

Molecular Formula

C162H267N51O48S3

Molecular Weight

3793.35

Specification
Reference Reading

IUPAC Name

(2S)-N-[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S,3R)-1-[[(2S)-4-amino-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-amino-1-oxo-3-phenylpropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]carbamoyl]pyrrolidin-1-yl]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(4R,7S,10S,13S,16S,19R)-16-(2-amino-2-oxoethyl)-19-[[(2S)-2-aminopropanoyl]amino]-7,13-bis[(1R)-1-hydroxyethyl]-10-methyl-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicosane-4-carbonyl]amino]-3-methylbutanoyl]amino]-3-hydroxybutanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]acetyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-hydroxypropanoyl]amino]acetyl]amino]acetyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]hexanoyl]amino]-3-hydroxypropanoyl]amino]butanediamide

Synonyms

H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (Disulfide bridge: Cys2-Cys7); Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human; α-Calcitonin gene-related peptide (human), 3-L-asparagine-22-L-methionine-25-L-serine-; β-Calcitonin gene-related peptide (human); L-Alanyl-L-cysteinyl-L-asparaginyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-valyl-L-threonyl-L-histidyl-L-arginyl-L-leucyl-L-alanylglycyl-L-leucyl-L-leucyl-L-seryl-L-arginyl-L-serylglycylglycyl-L-methionyl-L-valyl-L-lysyl-L-seryl-L-asparaginyl-L-phenylalanyl-L-valyl-L-prolyl-L-threonyl-L-asparaginyl-L-valylglycyl-L-seryl-L-lysyl-L-alanyl-L-phenylalaninamide cyclic (2→7)-disulfide; Human beta calcitonin gene-related peptide; Human calcitonin gene-related peptide 2; Human calcitonin gene-related peptide β; Human calcitonin gene-related peptide-II; Human calcitonin-related peptide II; Human β-calcitonin gene-related peptide

Appearance

White or Off-white Lyophilized Powder

Purity

95%

Sequence

ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge: Cys2-Cys7)

Storage

Store at -20°C

InChI

InChI=1S/C162H267N51O48S3/c1-74(2)53-98(186-118(227)65-178-130(231)82(16)182-139(240)99(54-75(3)4)193-135(236)94(43-34-49-175-161(170)171)188-142(243)102(58-91-62-174-73-181-91)198-158(259)127(88(22)221)212-155(256)122(79(11)12)207-151(252)111-72-264-263-71-110(203-129(230)81(15)165)150(251)197-104(60-114(167)223)146(247)210-124(85(19)218)156(257)184-84(18)132(233)209-125(86(20)219)159(260)204-111)140(241)194-100(55-76(5)6)141(242)202-108(69-216)148(249)190-95(44-35-50-176-162(172)173)137(238)200-106(67-214)133(234)179-63-116(225)177-64-117(226)185-96(46-52-262-23)138(239)206-121(78(9)10)154(255)191-93(42-31-33-48-164)136(237)201-109(70-217)149(250)196-103(59-113(166)222)143(244)195-101(57-90-39-28-25-29-40-90)144(245)208-123(80(13)14)160(261)213-51-36-45-112(213)152(253)211-126(87(21)220)157(258)199-105(61-115(168)224)145(246)205-120(77(7)8)153(254)180-66-119(228)187-107(68-215)147(248)189-92(41-30-32-47-163)134(235)183-83(17)131(232)192-97(128(169)229)56-89-37-26-24-27-38-89/h24-29,37-40,62,73-88,92-112,120-127,214-221H,30-36,41-61,63-72,163-165H2,1-23H3,(H2,166,222)(H2,167,223)(H2,168,224)(H2,169,229)(H,174,181)(H,177,225)(H,178,231)(H,179,234)(H,180,254)(H,182,240)(H,183,235)(H,184,257)(H,185,226)(H,186,227)(H,187,228)(H,188,243)(H,189,248)(H,190,249)(H,191,255)(H,192,232)(H,193,236)(H,194,241)(H,195,244)(H,196,250)(H,197,251)(H,198,259)(H,199,258)(H,200,238)(H,201,237)(H,202,242)(H,203,230)(H,204,260)(H,205,246)(H,206,239)(H,207,252)(H,208,245)(H,209,233)(H,210,247)(H,211,253)(H,212,256)(H4,170,171,175)(H4,172,173,176)/t81-,82-,83-,84-,85+,86+,87+,88+,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,120-,121-,122-,123-,124-,125-,126-,127-/m0/s1

InChI Key

UBUOWBUDQWYFBS-GWXQVRSKSA-N

Canonical SMILES

CC1C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)O)CC(=O)N)NC(=O)C(C)N)C(=O)NC(C(C)C)C(=O)NC(C(C)O)C(=O)NC(CC2=CNC=N2)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CCCNC(=N)N)C(=O)NC(CO)C(=O)NCC(=O)NCC(=O)NC(CCSC)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(CO)C(=O)NC(CC(=O)N)C(=O)NC(CC3=CC=CC=C3)C(=O)NC(C(C)C)C(=O)N4CCCC4C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C(C)C)C(=O)NCC(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C)C(=O)NC(CC5=CC=CC=C5)C(=O)N)C(C)O

1. Calcitonin gene-related peptide: physiology and pathophysiology

F A Russell, R King, S-J Smillie, X Kodji, S D Brain Physiol Rev. 2014 Oct;94(4):1099-142. doi: 10.1152/physrev.00034.2013.

Calcitonin gene-related peptide (CGRP) is a 37-amino acid neuropeptide. Discovered 30 years ago, it is produced as a consequence of alternative RNA processing of the calcitonin gene. CGRP has two major forms (α and β). It belongs to a group of peptides that all act on an unusual receptor family. These receptors consist of calcitonin receptor-like receptor (CLR) linked to an essential receptor activity modifying protein (RAMP) that is necessary for full functionality. CGRP is a highly potent vasodilator and, partly as a consequence, possesses protective mechanisms that are important for physiological and pathological conditions involving the cardiovascular system and wound healing. CGRP is primarily released from sensory nerves and thus is implicated in pain pathways. The proven ability of CGRP antagonists to alleviate migraine has been of most interest in terms of drug development, and knowledge to date concerning this potential therapeutic area is discussed. Other areas covered, where there is less information known on CGRP, include arthritis, skin conditions, diabetes, and obesity. It is concluded that CGRP is an important peptide in mammalian biology, but it is too early at present to know if new medicines for disease treatment will emerge from our knowledge concerning this molecule.

2. Calcitonin gene-related peptide (CGRP): a new target for migraine

Andrew F Russo Annu Rev Pharmacol Toxicol. 2015;55:533-52. doi: 10.1146/annurev-pharmtox-010814-124701. Epub 2014 Oct 8.

Migraine is a neurological disorder that manifests as a debilitating headache associated with altered sensory perception. The neuropeptide calcitonin gene-related peptide (CGRP) is now firmly established as a key player in migraine. Clinical trials carried out during the past decade have proved that CGRP receptor antagonists are effective for treating migraine, and antibodies to the receptor and CGRP are currently under investigation. Despite this progress in the clinical arena, the mechanisms by which CGRP triggers migraine remain uncertain. This review discusses mechanisms whereby CGRP enhances sensitivity to sensory input at multiple levels in both the periphery and central nervous system. Future studies on epistatic and epigenetic regulators of CGRP actions are expected to shed further light on CGRP actions in migraine. In conclusion, targeting CGRP represents an approachable therapeutic strategy for migraine.

3. CGRP as the target of new migraine therapies - successful translation from bench to clinic

Lars Edvinsson, Kristian Agmund Haanes, Karin Warfvinge, Diana N Krause Nat Rev Neurol. 2018 Jun;14(6):338-350. doi: 10.1038/s41582-018-0003-1.

Treatment of migraine is on the cusp of a new era with the development of drugs that target the trigeminal sensory neuropeptide calcitonin gene-related peptide (CGRP) or its receptor. Several of these drugs are expected to receive approval for use in migraine headache in 2018 and 2019. CGRP-related therapies offer considerable improvements over existing drugs as they are the first to be designed specifically to act on the trigeminal pain system, they are more specific and they seem to have few or no adverse effects. CGRP receptor antagonists such as ubrogepant are effective for acute relief of migraine headache, whereas monoclonal antibodies against CGRP (eptinezumab, fremanezumab and galcanezumab) or the CGRP receptor (erenumab) effectively prevent migraine attacks. As these drugs come into clinical use, we provide an overview of knowledge that has led to successful development of these drugs. We describe the biology of CGRP signalling, summarize key clinical evidence for the role of CGRP in migraine headache, including the efficacy of CGRP-targeted treatment, and synthesize what is known about the role of CGRP in the trigeminovascular system. Finally, we consider how the latest findings provide new insight into the central role of the trigeminal ganglion in the pathophysiology of migraine.