Need Assistance?
  • US & Canada:
    +
  • UK: +

Cliotide T1

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Cliotide T1 was found in Clitoria ternatea. It is active against Gram-negative bacteria E.coli, K.pneumoniae and P.aeruginosa. Cliotide T1 also has hemolytic and cytotoxic activity.

Category
Functional Peptides
Catalog number
BAT-013433
Sequence
GIPCGESCVFIPCITGAIGCSCKSKVCYRN
1. Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family
Giang Kien Truc Nguyen, Sen Zhang, Ngan Thi Kim Nguyen, Phuong Quoc Thuc Nguyen, Ming Sheau Chiu, Antony Hardjojo, James P Tam J Biol Chem. 2011 Jul 8;286(27):24275-87. doi: 10.1074/jbc.M111.229922. Epub 2011 May 19.
The tropical plant Clitoria ternatea is a member of the Fabaceae family well known for its medicinal values. Heat extraction of C. ternatea revealed that the bioactive fractions contained heat-stable cysteine-rich peptides (CRPs). The CRP family of A1b (Albumin-1 chain b/leginsulins), which is a linear cystine knot CRP, has been shown to present abundantly in the Fabaceae. In contrast, the cyclotide family, which also belongs to the cystine knot CRPs but with a cyclic structure, is commonly found in the Rubiaceae, Violaceae, and Cucurbitaceae families. In this study, we report the discovery of a panel of 15 heat-stable CRPs, of which 12 sequences (cliotide T1-T12) are novel. We show unambiguously that the cliotides are cyclotides and not A1bs, as determined by their sequence homology, disulfide connectivity, and membrane active properties indicated by their antimicrobial activities against Escherichia coli and cytotoxicities to HeLa cells. We also show that cliotides are prevalent in C. ternatea and are found in every plant tissue examined, including flowers, seeds, and nodules. In addition, we demonstrate that their precursors are chimeras, half from cyclotide and the other half from Albumin-1, with the cyclotide domain displacing the A1b domain in the precursor. Their chimeric structures likely originate from either horizontal gene transfer or convergent evolution in plant nuclear genomes, which are exceedingly rare events. Such atypical genetic arrangement also implies a different mechanism of biosynthetic processing of cyclotides in the Fabaceae and provides new understanding of their evolution in plants.
2. Mass Spectrometric Analysis of Cyclotides from Clitoria ternatea: Xxx-Pro Bond Fragmentation as Convenient Diagnostic of Pro Residue Positioning
Neha V Kalmankar, Padmanabhan Balaram, Radhika Venkatesan Chem Asian J. 2021 Oct 4;16(19):2920-2931. doi: 10.1002/asia.202100585. Epub 2021 Aug 4.
Cyclotides, a class of macrocyclic plant peptides, characterized by a cyclic backbone and three inter-locking disulfide bonds, may be divided into two major structural subfamilies, Möbius and Bracelet, based on the presence or absence of a specific proline residue. The present study describes the suite of cyclotides obtained from Clitoria ternatea, characterized by LC-MS and MS/MS techniques. Notable variations in product ion distributions were observed in cyclotides belonging to different structural subfamilies based on the number and positions of proline residues. For instance, Cter M which is an abundant Möbius cyclotide in this plant containing three proline residues, displayed distinct b- and y- ion characteristics in the MS/MS spectra compared to Cliotide T1, another commonly identified cyclotide but belonging to the Bracelet subfamily having two proline residues. The distinct fragmentation pattern of prototypical cyclotides of each structural subfamily, determined by Xxx-Pro bond fragmentation, was used to rapidly identify and sequence a novel cyclotide ctr pep 30 from this plant.
Online Inquiry
Inquiry Basket