Need Assistance?

US & Canada:
+
UK: +

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

Application Area

Cycloviolacin O17

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Cycloviolacin O17 is produced by Viola odorata. It probably participates in a plant defense mechanism.

Category

Functional Peptides

Catalog number

BAT-012354

Specification

Sequence

GIPCGESCVWIPCISAAIGCSCKNKVCYRN

Curvalicin-28c

CAT NO. : BAT-006247

Endothelin-3, human, mouse, rabbit, rat

CAT NO. : BAT-006178

Neuropeptide Y (29-64)

CAT NO. : BAT-009963

CAT NO. : BAT-006236

CAT NO. : BAT-006268

CAT NO. : BAT-006262

Online Inquiry

Name *

Email *

Phone *

Services & Products of Interest *

Project Description

Quantity *

Verification Code *

Verification code

Inquiry Basket

Loading ......

Delete selected Go to checkout