Need Assistance?
  • US & Canada:
    +
  • UK: +

Cycloviolacin O8

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Cycloviolacin O8 is produced by Viola odorata. It probably participates in a plant defense mechanism.

Category
Functional Peptides
Catalog number
BAT-012364
Sequence
GTLPCESCVWIPCISSVVGCSCKSKVCYKN
1. PepSAVI-MS reveals anticancer and antifungal cycloviolacins in Viola odorata
Nicole C Parsley, Christine L Kirkpatrick, Christopher M Crittenden, Javad Ghassemi Rad, David W Hoskin, Jennifer S Brodbelt, Leslie M Hicks Phytochemistry. 2018 Aug;152:61-70. doi: 10.1016/j.phytochem.2018.04.014. Epub 2018 May 21.
Widespread resistance to antimicrobial and cancer therapeutics is evolving in every country worldwide and has a direct impact on global health, agriculture and the economy. The specificity and selectivity of bioactive peptide natural products present a possible stopgap measure to address the ongoing deficit of new therapeutic compounds. PepSAVI-MS (Statistically-guided bioActive Peptides prioritized VIa Mass Spectrometry) is an adaptable method for the analysis of natural product libraries to rapidly identify bioactive peptides. This pipeline was validated via screening of the cyclotide-rich botanical species Viola odorata and identification of the known antimicrobial and anticancer cyclotide cycloviolacin O2. Herein we present and validate novel bioactivities of the anthelmintic V. odorata cyclotide, cycloviolacin O8 (cyO8), including micromolar anticancer activity against PC-3 prostate, MDA-MB-231 breast, and OVCAR-3 ovarian cancer cell lines and antifungal activity against the agricultural pathogen Fusarium graminearum. A reduction/alkylation strategy in tandem with PepSAVI-MS analysis also revealed several previously uncharacterized putatively bioactive cyclotides. Downstream implementation of ultraviolet photodissociation (UVPD) tandem mass spectrometry is demonstrated for cyO8 as a method to address traditionally difficult-to-sequence cyclotide species. This work emphasizes the therapeutic and agricultural potential of natural product bioactive peptides and the necessity of developing robust analytical tools to deconvolute nature's complexity.
2. The anthelmintic activity of the cyclotides: natural variants with enhanced activity
Michelle L Colgrave, Andrew C Kotze, David C Ireland, Conan K Wang, David J Craik Chembiochem. 2008 Aug 11;9(12):1939-45. doi: 10.1002/cbic.200800174.
The cyclotides are a family of backbone-cyclised cystine-knot-containing peptides from plants that possess anthelmintic activity against Haemonchus contortus and Trichostrongylus colubriformis, two important gastrointestinal nematode parasites of sheep. In the current study, we investigated the in vitro effects of newly discovered natural cyclotides on the viability of larval and adult life stages of these pests. The natural variants cycloviolacin O2, cycloviolacin O3, cycloviolacin O8, cycloviolacin O13, cycloviolacin O14, cycloviolacin O15, and cycloviolacin O16 extracted from Viola odorata showed up to 18-fold greater potency than the prototypic cyclotide kalata B1 in nematode larval development assays. Cycloviolacin O2 and cycloviolacin O14 were significantly more potent than kalata B1 in adult H. contortus motility assays. The lysine and glutamic acid residues of cycloviolacin O2, the most potent anthelmintic cyclotide, were chemically modified to investigate the role of these charged residues in modulating the biological activity. The single glutamic acid residue, which is conserved across all known cyclotides, was shown to be essential for activity, with a sixfold decrease in potency of cycloviolacin O2 following methylation. The three lysine residues present in cycloviolacin O2 were acetylated to effectively mask the positive charge, resulting in a 18-fold decrease in anthelmintic activity. The relative anthelmintic activities of the natural variants assayed against nematode larvae correlated with the number of charged residues present in their sequence.
3. Analysis of cyclotides in Viola ignobilis by Nano liquid chromatography fourier transform mass spectrometry
Hossein Hashempour, Alireza Ghassempour, Norelle L Daly, Bernhard Spengler, Andreas Römpp Protein Pept Lett. 2011 Jul;18(7):747-52. doi: 10.2174/092986611795446030.
Cyclotides are macrocyclic knotted peptides originating from plants. They are extremely stable and have a range of bioactivities including anti-HIV and insecticidal activity. Given the stability of the cyclotide framework, there is interest in using these peptides as scaffolds in drug design. In the current study, we have shown that nano-LC Fourier transform mass spectrometry (FTMS) is an effective method of analyzing cyclotides in plants. In addition, we have used this technique to find cyclotides in a novel species, Viola ignobilis (Violaceae plant family), which was collected from the West Azerbaijan province of Iran. Varv peptide A, cycloviolacin B2, and cycloviolacin O8 were found in this species. This study provides a novel method for directly analyzing cyclotide sequences without enzymatic digestion and further information regarding the distribution of cyclotides in plant species.
Online Inquiry
Verification code
Inquiry Basket