webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Need Assistance?
  • US & Canada:
    +
  • UK: +

DEFB30

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

DEFB30 is an antibacterial peptide isolated from Rattus norvegicus. It has activity against gram-negative bacteria.

Category
Functional Peptides
Catalog number
BAT-012673
Synonyms
Gly-Val-Asn-Met-Tyr-Ile-Arg-Gln-Ile-Tyr-Asp-Thr-Cys-Trp-Lys-Leu-Lys-Gly-His-Cys-Arg-Asn-Val-Cys-Gly-Lys-Lys-Glu-Ile-Phe-His-Ile-Phe-Cys-Gly-Thr-Gln-Phe-Leu-Cys-Cys-Ile-Glu-Arg-Lys-Glu-Met-Pro-Val-Leu-Phe-Val-Lys
Sequence
GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPVLFVK
1. Identification, cloning and functional characterization of novel beta-defensins in the rat (Rattus norvegicus)
Suresh Yenugu, Vishnu Chintalgattu, Christopher J Wingard, Yashwanth Radhakrishnan, Frank S French, Susan H Hall Reprod Biol Endocrinol. 2006 Feb 4;4:7. doi: 10.1186/1477-7827-4-7.
Background: Beta-defensins are small cationic peptides that exhibit broad spectrum antimicrobial properties. The majority of beta-defensins identified in humans are predominantly expressed in the male reproductive tract and have roles in non-immunological processes such as sperm maturation and capacitation. Characterization of novel defensins in the male reproductive tract can lead to increased understanding of their dual roles in immunity and sperm maturation. Methods: In silico rat genomic analyses were used to identify novel beta-defensins related to human defensins 118-123. RNAs isolated from male reproductive tract tissues of rat were reverse transcribed and PCR amplified using gene specific primers for defensins. PCR products were sequenced to confirm their identity. RT-PCR analysis was performed to analyze the tissue distribution, developmental expression and androgen regulation of these defensins. Recombinant defensins were tested against E. coli in a colony forming unit assay to analyze their antimicrobial activities. Results: Novel beta-defensins, Defb21, Defb24, Defb27, Defb30 and Defb36 were identified in the rat male reproductive tract. Defb30 and Defb36 were the most restricted in expression, whereas the others were expressed in a variety of tissues including the female reproductive tract. Early onset of defensin expression was observed in the epididymides of 10-60 day old rats. Defb21-Defb36 expression in castrated rats was down regulated and maintained at normal levels in testosterone supplemented animals. DEFB24 and DEFB30 proteins showed potent dose and time dependent antibacterial activity. Conclusion: Rat Defb21, Defb24, Defb27, Defb30 and Defb36 are abundantly expressed in the male reproductive tract where they most likely protect against microbial invasion. They are developmentally regulated and androgen is required for full expression in the adult epididymis.
2. Genetic resistance to DEHP-induced transgenerational endocrine disruption
Ludwig Stenz, Rita Rahban, Julien Prados, Serge Nef, Ariane Paoloni-Giacobino PLoS One. 2019 Jun 10;14(6):e0208371. doi: 10.1371/journal.pone.0208371. eCollection 2019.
Di(2-ethylhexyl)phthalate (DEHP) interferes with sex hormones signaling pathways (SHP). C57BL/6J mice prenatally exposed to 300 mg/kg/day DEHP develop a testicular dysgenesis syndrome (TDS) at adulthood, but similarly-exposed FVB/N mice are not affected. Here we aim to understand the reasons behind this drastic difference that should depend on the genome of the strain. In both backgrounds, pregnant female mice received per os either DEHP or corn oil vehicle and the male filiations were examined. Computer-assisted sperm analysis showed a DEHP-induced decreased sperm count and velocities in C57BL/6J. Sperm RNA sequencing experiments resulted in the identification of the 62 most differentially expressed RNAs. These RNAs, mainly regulated by hormones, produced strain-specific transcriptional responses to prenatal exposure to DEHP; a pool of RNAs was increased in FVB, another pool of RNAs was decreased in C57BL/6J. In FVB/N, analysis of non-synonymous single nucleotide polymorphisms (SNP) impacting SHP identified rs387782768 and rs29315913 respectively associated with absence of the Forkhead Box A3 (Foxa3) RNA and increased expression of estrogen receptor 1 variant 4 (NM_001302533) RNA. Analysis of the role of SNPs modifying SHP binding sites in function of strain-specific responses to DEHP revealed a DEHP-resistance allele in FVB/N containing an additional FOXA1-3 binding site at rs30973633 and four DEHP-induced beta-defensins (Defb42, Defb30, Defb47 and Defb48). A DEHP-susceptibility allele in C57BL/6J contained five SNPs (rs28279710, rs32977910, rs46648903, rs46677594 and rs48287999) affecting SHP and six genes (Svs2, Svs3b, Svs4, Svs3a, Svs6 and Svs5) epigenetically silenced by DEHP. Finally, targeted experiments confirmed increased methylation in the Svs3ab promoter with decreased SEMG2 persisting across generations, providing a molecular explanation for the transgenerational sperm velocity decrease found in C57BL/6J after DEHP exposure. We conclude that the existence of SNP-dependent mechanisms in FVB/N inbred mice may confer resistance to transgenerational endocrine disruption.
Online Inquiry
Inquiry Basket