Need Assistance?
  • US & Canada:
    +
  • UK: +

Geobacillin I

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Geobacillin I is from the thermophilic bacterium Geobacillus thermodenitrificans NG80-2. The antimicrobial spectrum of geobacillin I was generally similar to that of nisin A, with increased activity against Streptococcus dysgalactiae, one of the causative agents of bovine mastitis.

Category
Functional Peptides
Catalog number
BAT-012045
Sequence
VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC
2. Lantibiotics from Geobacillus thermodenitrificans
Neha Garg, Weixin Tang, Yuki Goto, Satish K Nair, Wilfred A van der Donk Proc Natl Acad Sci U S A. 2012 Apr 3;109(14):5241-6. doi: 10.1073/pnas.1116815109. Epub 2012 Mar 19.
The lantibiotic nisin has been used as an effective food preservative to combat food-borne pathogens for over 40 y. Despite this successful use, nisin's stability at pH 7 is limited. Herein, we describe a nisin analog encoded on the genome of the thermophilic bacterium Geobacillus thermodenitrificans NG80-2. This analog termed geobacillin I was obtained by heterologous expression in Escherichia coli and subsequent purification. Extensive NMR characterization demonstrated that geobacillin I contains seven thioether cross-links, two more than the five cross-links found in nisin and the most cross-links found in any lantibiotic to date. The antimicrobial spectrum of geobacillin I was generally similar to that of nisin A, with increased activity against Streptococcus dysgalactiae, one of the causative agents of bovine mastitis. Geobacillin I demonstrated increased stability compared to nisin A. In addition to geobacillin I, the genome of G. thermodenitrificans NG80-2 also contains a class II lantibiotic biosynthetic gene cluster. The corresponding compound was produced in E. coli, and has a ring topology different than that of any known lantibiotic as determined by tandem mass spectrometry. Interestingly, geobacillin II only demonstrated antimicrobial activity against Bacillus strains. Seven Geobacillus strains were screened for production of the geobacillins using whole-cell MALDI-MS and five were shown to produce geobacillin I, but none produced geobacillin II.
3. In silico Prediction and Exploration of Potential Bacteriocin Gene Clusters Within the Bacterial Genus Geobacillus
Kevin Egan, Des Field, R Paul Ross, Paul D Cotter, Colin Hill Front Microbiol. 2018 Sep 20;9:2116. doi: 10.3389/fmicb.2018.02116. eCollection 2018.
The thermophilic, endospore-forming genus of Geobacillus has historically been associated with spoilage of canned food. However, in recent years it has become the subject of much attention due its biotechnological potential in areas such as enzyme and biofuel applications. One aspect of this genus that has not been fully explored or realized is its use as a source of novel forms of the ribosomally synthesized antimicrobial peptides known as bacteriocins. To date only two bacteriocins have been fully characterized within this genus, i.e., Geobacillin I and II, with only a small number of others partially characterized. Here we bioinformatically investigate the potential of this genus as a source of novel bacteriocins through the use of the in silico screening software BAGEL3, which scans publically available genomes for potential bacteriocin gene clusters. In this study we examined the association of bacteriocin gene presence with niche and phylogenetic position within the genus. We also identified a number of candidates from multiple bacteriocin classes which may be promising antimicrobial candidates when investigated in vitro in future studies.
Online Inquiry
Verification code
Inquiry Basket