webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Need Assistance?
  • US & Canada:
    +
  • UK: +

HBD-27

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

HBD-27 is isolated from Homo sapiens with antibacterial activity.

Category
Functional Peptides
Catalog number
BAT-012104
Synonyms
Hemoglobin subunit delta-27
Sequence
QLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC
1. Refinement of coding SNPs in the human aryl hydrocarbon receptor gene using ISNPranker: An integrative-SNP ranking web-tool
Younes Aftabi, et al. Comput Biol Chem. 2021 Feb;90:107416. doi: 10.1016/j.compbiolchem.2020.107416. Epub 2020 Nov 17.
Different bioinformatic methods apply various approaches to predict how much the effect of a SNP could be deleterious and therefore their results may differ significantly. However, variation studies often need to consider an integrated prediction result to analyze the effect of SNPs. To address this problem, we used an algorithm to map ordinal predictions to a numeral space and averaging them, and based on it we developed the ISNPranker web-tool (http://isnpranker.semilab.ir/). It takes heterogonous outputs of different predictors and generates integrated numerical predictions and ranks SNPs based on them. Afterward, we used ISNPranker to identify the most deleterious coding SNPs (cSNPs) of the human aryl hydrocarbon receptor (AHR) gene. AHR is a ligand-activated transcription factor that governs many molecular and cellular mechanisms and cSNPs may affect its structure, interactions, and function. Forty validated cSNPs of AHR were initially analyzed using 16 publicly available SNP analyzers and the results were introduced to the ISNPranker and integrated predictions were obtained. The cSNPs were ranked in 34 levels of danger and rs200257782 in the ARNT dimerization domain (ADD121-289) of AHR was identified as the most deleterious cSNP. The rs148360742, which affect ADD40-79 and Hsp90 binding domain (HBD27-79) was in the second rank and the third and fourth ranks were occupied by ADD121-289-located variations rs571123681 and rs141667112 respectively. In conclusion, we introduced ISNPranker, which is a web-tool for integrative ranking of SNPs, and we showed that AHR structure and function may be highly sensitive to the cSNPs in the ARNT dimerization domain.
2. Engineering disulfide bonds of the novel human beta-defensins hBD-27 and hBD-28: differences in disulfide formation and biological activity among human beta-defensins
Axel Schulz, Enno Klüver, Sandra Schulz-Maronde, Knut Adermann Biopolymers. 2005;80(1):34-49. doi: 10.1002/bip.20193.
Human beta-defensins comprise a large number of peptides that play a functional role in the innate and adaptive immune system. Recently, clusters of new beta-defensin genes with predominant expression in testicular tissue have been discovered on different chromosomes by bioinformatics. beta-Defensins share a common pattern of three disulfides that are essential for their biological effects. Here we report for the first time the chemical synthesis of the new fully disulfide-bonded beta-defensins hBD-27 and hBD-28, and compare the results with synthetic procedures to obtain the known hBD-2 and hBD-3. While hBD-27 was readily converted into a product with the desired disulfide pattern by oxidative folding, hBD-28 required a selective protective group strategy to introduce the three disulfide bonds. The established synthetic processes were applied to the synthesis of hBD-2, which, like hBD-27, was accessible by oxidative folding, whereas hBD-3 required a selective strategy comparable to hBD-28. Experimental work demonstrated that trityl, acetamidomethyl, and t-butyl are superior to other protection strategies. However, the suitable pairwise arrangement of the protective groups can be different, as shown here for hBD-3 and hBD-28. Determination of the minimum inhibitory concentration against different bacteria revealed that hBD-27, in contrast to other beta-defensins tested, has virtually no antimicrobial activity. Compared to the other peptides tested, hBD-27 showed almost no cytotoxic activity, measured by hemoglobin release of erythrocytes. This might be due to the low positive net charge, which is significantly higher for hBD-2, hBD-3, and hBD-28.
3. IgA anti-beta-2 glycoprotein I antibodies in chronic hepatitis C
Sarra Melayah, Ouafa Kallala, Mariem Ben Ahmed, Imen Fodha, Saloua Yacoub Jemni, Ibtissem Ghedira, Amani Mankaï Arab J Gastroenterol. 2022 Feb;23(1):26-31. doi: 10.1016/j.ajg.2021.12.003. Epub 2022 Feb 2.
Background and study aims: Antiphospholipid antibodies (aPL) have been reported not only in various autoimmune conditions but also in other infections, such as chronic hepatitis C (CHC) infection. The aim of this study is to evaluate the frequency of aPL in patients with CHC. Patients and methods: Ninety-six CHC patients and 90 healthy blood donors (HBD) were studied. Fifty-three of the patients were under treatment, and 43 had not yet received any treatment. IgG, IgA, and IgM antibodies against cardiolipin (aCL) and beta-2 glycoprotein I (aβ2GPI) were detected by ELISA. Results: We found that the frequency of aPL (aCL and/or aβ2GPI) was significantly higher in CHC patients than in controls (51% vs 11.1%, p <10-6). The frequencies of aCL and aβ2GPI were significantly higher in patients than in HBD (27.1% vs 5.5%, p < 10-3, and 44.8% vs 11.1%, p < 10-6, respectively). The isotype distribution of aCL and aβ2GPI demonstrated that aCL-IgG and aβ2GPI-IgA were more frequent in patients than in healthy subjects (21.9% vs 2.2%, p < 10-3, and 38.5% vs 7.8%, p < 10-6, respectively). In CHC patients, the frequency of aβ2GPI was significantly higher than that of aCL (44.8% vs 27.1%, p = 0.01). aβ2GPI-IgA was significantly more frequent than aβ2GPI-IgG (38.5% vs 7.3%, p <10-6), aβ2GPI-IgM (38.5% vs 9.4%, p <10-3), and aCL-IgG (38.5% vs 21.9%, p = 0.01). No difference in aPL frequency was observed between the treated and untreated patients. Conclusion: On the basis of the findings of this study, aPL, particularly aβ2GPI-IgA and aCL-IgG, are frequent in CHC patients.
Online Inquiry
Inquiry Basket