webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Moricin-like peptide C3
Need Assistance?
  • US & Canada:
    +1-844-BOC(262)-0123
  • UK: +44-20-3286-1088

Moricin-like peptide C3

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria.

Category
Functional Peptides
Catalog number
BAT-011929
Sequence
KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
1. A different repertoire of Galleria mellonella antimicrobial peptides in larvae challenged with bacteria and fungi
Pawel Mak, Agnieszka Zdybicka-Barabas, Małgorzata Cytryńska Dev Comp Immunol. 2010 Oct;34(10):1129-36. doi: 10.1016/j.dci.2010.06.005. Epub 2010 Jun 23.
To date, functioning of insect humoral immune response is especially well described in Diptera. The mechanisms of pathogen recognition, activation of signaling pathways and regulation of antimicrobial defense peptide expression are relatively well known. The present paper demonstrates evidence that the immune system of the Lepidoptera moth, Galleria mellonella, is also able to distinguish between different classes of microorganisms and responds to the invading pathogen accordingly. G. mellonella larvae were challenged with Gram-negative and Gram-positive bacteria as well as with yeast and filamentous fungus cells. Subsequently, 24, 48 and 72 h after immunization, the concentrations of lysozyme and six defense peptides were determined in the hemolymph by the HPLC technique. The compounds studied demonstrated variability both in the kinetics of the increase as well as in the concentrations reached. The Gram-negative bacterium and filamentous fungus were particularly effective immunogens, especially affecting the levels of lysozyme, Galleria defensin, proline-rich peptide 2 and cecropin D-like peptide.
2. A peptidomics study reveals the impressive antimicrobial peptide arsenal of the wax moth Galleria mellonella
Susan E Brown, Antoinette Howard, Annette B Kasprzak, Karl H Gordon, Peter D East Insect Biochem Mol Biol. 2009 Nov;39(11):792-800. doi: 10.1016/j.ibmb.2009.09.004. Epub 2009 Sep 26.
The complete antimicrobial peptide repertoire of Galleria mellonella was investigated for the first time by LC/MS. Combining data from separate trypsin, Glu-C and Asp-N digests of immune hemolymph allowed detection of 18 known or putative G. mellonella antimicrobial peptides or proteins, namely lysozyme, moricin-like peptides (5), cecropins (2), gloverin, Gm proline-rich peptide 1, Gm proline-rich peptide 2, Gm anionic peptide 1 (P1-like), Gm anionic peptide 2, galiomicin, gallerimycin, inducible serine protease inhibitor 2, 6tox and heliocin-like peptide. Six of these were previously known only as nucleotide sequences, so this study provides the first evidence for expression of these genes. LC/MS data also provided insight into the expression and processing of the antimicrobial Gm proline-rich peptide 1. The gene for this peptide was isolated and shown to be unique to moths and to have an unusually long precursor region (495 bp). The precursor region contained other proline-rich peptides and LC/MS data suggested that these were being specifically processed and were present in hemolymph at very high levels. This study shows that G. mellonella can concurrently release an impressive array of at least 18 known or putative antimicrobial peptides from 10 families to defend itself against invading microbes.
3. Purification and characterization of eight peptides from Galleria mellonella immune hemolymph
Małgorzata Cytryńska, Paweł Mak, Agnieszka Zdybicka-Barabas, Piotr Suder, Teresa Jakubowicz Peptides. 2007 Mar;28(3):533-46. doi: 10.1016/j.peptides.2006.11.010. Epub 2006 Dec 27.
Defense peptides play a crucial role in insect innate immunity against invading pathogens. From the hemolymph of immune-challenged greater wax moth, Galleria mellonella (Gm) larvae, eight peptides were isolated and characterized. Purified Gm peptides differ considerably in amino acid sequences, isoelectric point values and antimicrobial activity spectrum. Five of them, Gm proline-rich peptide 2, Gm defensin-like peptide, Gm anionic peptides 1 and 2 and Gm apolipophoricin, were not described earlier in G. mellonella. Three others, Gm proline-rich peptide 1, Gm cecropin D-like peptide and Galleria defensin, were identical with known G. mellonella peptides. Gm proline-rich peptides 1 and 2 and Gm anionic peptide 2, had unique amino acid sequences and no homologs have been found for these peptides. Antimicrobial activity of purified peptides was tested against gram-negative and gram-positive bacteria, yeast and filamentous fungi. The most effective was Gm defensin-like peptide which inhibited fungal and sensitive bacteria growth in a concentration of 2.9 and 1.9 microM, respectively. This is the first report describing at least a part of defense peptide repertoire of G. mellonella immune hemolymph.
Online Inquiry
0
Inquiry Basket

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

x