Neutrophil cationic peptide 1
Need Assistance?
  • US & Canada:
    +
  • UK: +

Neutrophil cationic peptide 1

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Neutrophil cationic peptide 1 is an antimicrobial peptide found in Cavia porcellus (Guinea pig), and has antibacterial, antiviral and antifungal activity.

Category
Functional Peptides
Catalog number
BAT-011883
Synonyms
GPNP; Antiviral defensin; GNCP-1
Appearance
Lyophilized Powder
Purity
>85%
Sequence
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC
Storage
Store at -20°C
1. IL-33/ST2 induces neutrophil-dependent reactive oxygen species production and mediates gout pain
Chengyu Yin, et al. Theranostics. 2020 Oct 27;10(26):12189-12203. doi: 10.7150/thno.48028. eCollection 2020.
Objective: Gout, induced by monosodium urate (MSU) crystal deposition in joint tissues, provokes severe pain and impacts life quality of patients. However, the mechanisms underlying gout pain are still incompletely understood. Methods: We established a mouse gout model by intra-articularly injection of MSU crystals into the ankle joint of wild type and genetic knockout mice. RNA-Sequencing, in vivo molecular imaging, Ca2+ imaging, reactive oxygen species (ROS) generation, neutrophil influx and nocifensive behavioral assays, etc. were used. Results: We found interleukin-33 (IL-33) was among the top up-regulated cytokines in the inflamed ankle. Neutralizing or genetic deletion of IL-33 or its receptor ST2 (suppression of tumorigenicity) significantly ameliorated pain hypersensitivities and inflammation. Mechanistically, IL-33 was largely released from infiltrated macrophages in inflamed ankle upon MSU stimulation. IL-33 promoted neutrophil influx and triggered neutrophil-dependent ROS production via ST2 during gout, which in turn, activated transient receptor potential ankyrin 1 (TRPA1) channel in dorsal root ganglion (DRG) neurons and produced nociception. Further, TRPA1 channel activity was significantly enhanced in DRG neurons that innervate the inflamed ankle via ST2 dependent mechanism, which results in exaggerated nociceptive response to endogenous ROS products during gout. Conclusions: We demonstrated a previous unidentified role of IL-33/ST2 in mediating pain hypersensitivity and inflammation in a mouse gout model through promoting neutrophil-dependent ROS production and TRPA1 channel activation. Targeting IL-33/ST2 may represent a novel therapeutic approach to ameliorate gout pain and inflammation.
2. The Role of Macrophages in Staphylococcus aureus Infection
Grace R Pidwill, Josie F Gibson, Joby Cole, Stephen A Renshaw, Simon J Foster Front Immunol. 2021 Jan 19;11:620339. doi: 10.3389/fimmu.2020.620339. eCollection 2020.
Staphylococcus aureus is a member of the human commensal microflora that exists, apparently benignly, at multiple sites on the host. However, as an opportunist pathogen it can also cause a range of serious diseases. This requires an ability to circumvent the innate immune system to establish an infection. Professional phagocytes, primarily macrophages and neutrophils, are key innate immune cells which interact with S. aureus, acting as gatekeepers to contain and resolve infection. Recent studies have highlighted the important roles of macrophages during S. aureus infections, using a wide array of killing mechanisms. In defense, S. aureus has evolved multiple strategies to survive within, manipulate and escape from macrophages, allowing them to not only subvert but also exploit this key element of our immune system. Macrophage-S. aureus interactions are multifaceted and have direct roles in infection outcome. In depth understanding of these host-pathogen interactions may be useful for future therapeutic developments. This review examines macrophage interactions with S. aureus throughout all stages of infection, with special emphasis on mechanisms that determine infection outcome.
3. The neutrophil antimicrobial peptide cathelicidin promotes Th17 differentiation
Danielle Minns, et al. Nat Commun. 2021 Feb 24;12(1):1285. doi: 10.1038/s41467-021-21533-5.
The host defence peptide cathelicidin (LL-37 in humans, mCRAMP in mice) is released from neutrophils by de-granulation, NETosis and necrotic death; it has potent anti-pathogen activity as well as being a broad immunomodulator. Here we report that cathelicidin is a powerful Th17 potentiator which enhances aryl hydrocarbon receptor (AHR) and RORγt expression, in a TGF-β1-dependent manner. In the presence of TGF-β1, cathelicidin enhanced SMAD2/3 and STAT3 phosphorylation, and profoundly suppressed IL-2 and T-bet, directing T cells away from Th1 and into a Th17 phenotype. Strikingly, Th17, but not Th1, cells were protected from apoptosis by cathelicidin. We show that cathelicidin is released by neutrophils in mouse lymph nodes and that cathelicidin-deficient mice display suppressed Th17 responses during inflammation, but not at steady state. We propose that the neutrophil cathelicidin is required for maximal Th17 differentiation, and that this is one method by which early neutrophilia directs subsequent adaptive immune responses.
Online Inquiry
Verification code
Inquiry Basket