Neutrophil defensin 3
Need Assistance?
  • US & Canada:
    +
  • UK: +

Neutrophil defensin 3

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Neutrophil defensin 3 is an antimicrobial peptide found in Macaca mulatta (Rhesus monkey), and has antibacterial and antifungal activity.

Category
Functional Peptides
Catalog number
BAT-011874
Molecular Formula
C157H231N49O37S6
Molecular Weight
3589.28
Synonyms
RMAD-3
Appearance
Lyophilized Powder
Purity
>85%
Sequence
ACYCRIPACLAGERRYGTCFYRRRVWAFCC (Disulfide bridge: Cys2-Cys30, Cys4-Cys19, Cys9-Cys29)
Storage
Store at -20°C
1. Human Neutrophil Defensin-1, -3, and -4 Are Elevated in Nasal Aspirates from Children with Naturally Occurring Adenovirus Infection
V S Priyadharshini, F Ramírez-Jiménez, M Molina-Macip, C Renteria-Rosales, J Santiago-Cruz, Paola Zarate-Segura, E Lara-Padilla, Luis M Teran Can Respir J. 2018 Jul 31;2018:1038593. doi: 10.1155/2018/1038593. eCollection 2018.
Background: Adenoviruses are highly contagious pathogens which cause respiratory disease particularly in children; they may induce severe disease in infants. Human neutrophil peptides (HNPs) have been found to exhibit antiadenoviral activity. Thus, we have investigated HNPs in nasal aspirates (NAs) of children suffering from adenoviral common cold. Objective: To investigate the release of HNP-1-4 in adenovirus infection and the relationship with self-limiting upper respiratory tract infections. Methods: Nasal aspirate samples (n=14) were obtained from children (aged 6-12 years) infected with adenovirus between June 2012 and December 2015. Control samples were taken 4 weeks after infection when the children were asymptomatic. Levels of HNPs were measured using an enzyme-linked immunosorbent assay (ELISA). Results: There were increased levels of HNP-1, -3, and -4, but not HNP-2, in nasal aspirates (NAs) during adenovirus infections compared to healthy specimens (p ≤ 0.01). Moreover, there was also increase in the neutrophil count, which is a known cell source of HNPs. Conclusion: Our finding supports the involvement of HNP-1, -3, and -4 in naturally occurring cold in children infected with adenovirus. Because of their known antiviral properties, it is tempting to hypothesize that HNPs might play a protective role in adenovirus-induced respiratory disease; however, this remains to be shown.
2. Pathogenesis of psoriasis and development of treatment
Eisaku Ogawa, Yuki Sato, Akane Minagawa, Ryuhei Okuyama J Dermatol. 2018 Mar;45(3):264-272. doi: 10.1111/1346-8138.14139. Epub 2017 Dec 10.
The pathogenesis of psoriasis can be explained by dysregulation of immunological cell function as well as keratinocyte proliferation/differentiation. Recently, the immunological pathomechanism has been clarified substantially. Whereas T-helper (Th)1 overactivation was thought to induce occurrence of psoriasis, it has been demonstrated that Th17 cells play a key role. Th17 development is maintained by interleukin (IL)-23 mainly produced by dendritic cells. Th17 cells produce various cytokines, including IL-17A, IL-17F and IL-22. IL-17A and IL-22 induce not only keratinocyte proliferation, but also tumor necrosis factor (TNF)-α, chemokine (C-X-C motif) ligand (CXCL)1 and CXCL8 production. TNF-α accelerates the infiltration of inflammatory cells, including lymphocytes, monocytes and neutrophils, from the peripheral blood into skin with dendritic cell activation. In addition, antimicrobial peptides are overexpressed in psoriatic skin lesions, and the antimicrobial peptide, LL-37, activates dendritic cells, which leads to the development of inflammation. Furthermore, activation of nuclear factor-κB signal induces the expression of keratins 6 and 16 in keratinocytes, which are associated with acanthosis and reduced turnover time in the epidermis. The progression of the pathomechanism contributes to the development of new therapies for psoriasis.
3. Elevated Tear Human Neutrophil Peptides 1-3, Human Beta Defensin-2 Levels and Conjunctival Cathelicidin LL-37 Gene Expression in Ocular Rosacea
Nesrin Büyüktortop Gökçınar, Ayşe Anıl Karabulut, Zafer Onaran, Erhan Yumuşak, Fatma Azize Budak Yıldıran Ocul Immunol Inflamm. 2019;27(7):1174-1183. doi: 10.1080/09273948.2018.1504971. Epub 2018 Aug 24.
Purpose: To investigate the role of innate immunity in ocular rosacea. Methods: Thirty-two patients with ocular rosacea patients (group-1) and 28 healthy volunteers (group-2) who served as controls were enrolled in the study. Tear function parameters were assessed, conjunctival impression cytology was performed and tear samples were collected. Human-neutrophil-peptides (HNP) 1-3 and human-beta-defensin-2 (hBD-2) levels were measured in tears by using ELISA tests. Cathelicidin leucin-leucin-37 (LL-37), hBD-2, human-beta-defensin-9 (hBD-9) gene expression levels were measured in the conjunctival impression cytology samples using real-time polymerase chain reaction. Results: Tear HNP1-3 (p = 0.024), hBD-2 (p < 0.001), conjunctival LL-37 gene expression rate (p = 0.014) and ocular surface disease index scores (p = 0.001) were higher and the tear break-up time was lower (p = 0.003) in group-1. No other differences were found between the groups. Conclusion: The results of this study suggest the role of abnormal innate immunity in the pathophysiology of ocular rosacea by revealing elevated antimicrobial peptide levels.
Online Inquiry
Verification code
Inquiry Basket