Need Assistance?
  • US & Canada:
    +1-844-BOC(262)-0123
  • UK: +44-20-3286-1088

NmDef02

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

NmDef02 is an antimicrobial peptide found in Nicotiana megalosiphon, and has antimicrobial activity. It belongs to the defensin family.

Category
Functional Peptides
Catalog number
BAT-011759
Synonyms
Putative defensin
Purity
>98%
Sequence
RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC
1. Field Resistance to Phakopsora pachyrhizi and Colletotrichum truncatum of Transgenic Soybean Expressing the NmDef02 Plant Defensin Gene
Natacha Soto, Yuniet Hernández, Celia Delgado, Yamilka Rosabal, Rodobaldo Ortiz, Laura Valencia, Orlando Borrás-Hidalgo, Merardo Pujol, Gil A Enríquez Front Plant Sci. 2020 May 26;11:562. doi: 10.3389/fpls.2020.00562. eCollection 2020.
Fungal diseases lead to significant losses in soybean yields and a decline in seed quality; such is the case of the Asian soybean rust and anthracnose caused by Phakopsora pachyrhizi and Colletotrichum truncatum, respectively. Currently, the development of transgenic plants carrying antifungal defensins offers an alternative for plant protection against pathogens. This paper shows the production of transgenic soybean plants expressing the NmDef02 defensin gene using the biolistic delivery system, in an attempt to improve resistance against diseases and reduce the need for chemicals. Transgenic lines were assessed in field conditions under the natural infections of P. pachyrhizi and C. truncatum. The constitutive expression of the NmDef02 gene in transgenic soybean plants was shown to enhance resistance against these important plant pathogens. The quantification of the P. pachyrhizi biomass in infected soybean leaves revealed significant differences between transgenic lines and the non-transgenic control. In certain transgenic lines there was a strong reduction of fungal biomass, revealing a less severe disease. Integration and expression of the transgenes were confirmed by PCR, Southern blot, and qRT-PCR, where the Def1 line showed a higher relative expression of defensin. It was also found that the expression of the NmDef02 defensin gene in plants of the Def1 line did not have a negative effect on the nodulation induced by Bradyrhizobium japonicum. These results indicate that transgenic soybean plants expressing the NmDef02 defensin gene have a substantially enhanced resistance to economically important diseases, providing a sound environmental approach for decreasing yield losses and lowering the burden of chemicals in agriculture.
2. NmDef02, a novel antimicrobial gene isolated from Nicotiana megalosiphon confers high-level pathogen resistance under greenhouse and field conditions
Roxana Portieles, et al. Plant Biotechnol J. 2010 Aug;8(6):678-90. doi: 10.1111/j.1467-7652.2010.00501.x.
Plant defensins are small cysteine-rich peptides that inhibit the growth of a broad range of microbes. In this article, we describe NmDef02, a novel cDNA encoding a putative defensin isolated from Nicotiana megalosiphon upon inoculation with the tobacco blue mould pathogen Peronospora hyoscyami f.sp. tabacina. NmDef02 was heterologously expressed in the yeast Pichia pastoris, and the purified recombinant protein was found to display antimicrobial activity in vitro against important plant pathogens. Constitutive expression of NmDef02 gene in transgenic tobacco and potato plants enhanced resistance against various plant microbial pathogens, including the oomycete Phytophthora infestans, causal agent of the economically important potato late blight disease, under greenhouse and field conditions.
Online Inquiry
0
Inquiry Basket

No data available, please add!

Delete selectedGo to checkout

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

x