Need Assistance?
  • US & Canada:
    +
  • UK: +

Ostricacin-1

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Ostricacin-1 is an antimicrobial peptide found in Struthio camelus (Common ostrich), and has antibacterial activity.

Category
Functional Peptides
Catalog number
BAT-011869
Molecular Formula
C182H261N51O41S6
Molecular Weight
4011.81
Synonyms
Osp-1; Beta-defensin 2
Appearance
Lyophilized Powder or Liquid
Purity
>85%
Sequence
LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV (Disulfide bridge: Cys3-Cys29, Cys8-Cys23, Cys13-Cys30)
Storage
Store at -20°C
1. Identification of three novel ostricacins: an update on the phylogenetic perspective of beta-defensins
Haryadi Sugiarto, Pak-Lam Yu Int J Antimicrob Agents. 2006 Mar;27(3):229-35. doi: 10.1016/j.ijantimicag.2005.10.013. Epub 2006 Feb 3.
Three new beta-defensins, ostricacins-2, 3 and 4 (Osp-2, 3 and 4), have been successfully purified and characterised from ostrich heterophils in addition to ostricacin-1 (Osp-1). These peptides are composed of 36-42 amino acids with a molecular weight range of 4.70-4.98 kDa. In vitro, Osp-1, 3 and 4 were active against Escherichia coli O157:H7 and Staphylococcus aureus 1056 MRSA, whilst Osp-2 was active against bacterial strains plus the yeast Candida albicans 3153A. Minimal inhibitory concentrations of the three ostricacins ranged from 0.96 microg/mL to 12.03 microg/mL. Comparison with the known beta-defensins from mammalian and other avian species revealed that the four ostricacins shared eight conserved residues (six cysteines and two glycines), identified as the 'beta-defensin core motif'. Comparisons of the sequence also indicated that beta-defensins could have originated from a common beta-defensin-like ancestor that occurred before avian and mammalian lines diverged.
2. Effects of cations on antimicrobial activity of ostricacins-1 and 2 on E. coli O157:H7 and S. aureus 1056MRSA
Haryadi Sugiarto, Pak-Lam Yu Curr Microbiol. 2007 Jul;55(1):36-41. doi: 10.1007/s00284-006-0554-z. Epub 2007 Jun 6.
Ostricacin-1 and ostricacin-2 (Osp-1 and Osp-2) were beta-defensins antimicrobial peptides that were purified from ostrich leukocytes using a cation-exchange column and a semi-prep RP-HPLC column. Both ostricacins were subjected to increased concentrations of monovalent cations (K(+) and Na(+)) and divalent cations (Ca(2+) and Mg(2+)) in order to investigate the effect of cations on the activity of these ostricacins on Gram-negative bacteria and Gram-positive bacteria. The radial diffusion assay method showed that both ostricacins were sensitive to the presence of cations. The divalent cations showed more antagonized effect on the activity against Gram-negative bacteria than the monovalent cations, as the ostricacins lost ability to inhibit bacterial growth at very low concentration (5 mM). When viewed in the context of other defensins activity, our data support a hypothesis that defensins' overall net positive charge determine the sensitivity to cations.
Online Inquiry
Verification code
Inquiry Basket