Need Assistance?
  • US & Canada:
    +
  • UK: +

Palicourein

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Palicourein is an antimicrobial peptide found in Palicourea condensata (Cappel), and has antiviral activity.

Category
Functional Peptides
Catalog number
BAT-011678
CAS number
331714-57-9
Molecular Formula
C159H248N48O55S6
Molecular Weight
3904.35
IUPAC Name
3-[(aS,1R,3aS,4S,6aS,7R,9aS,10S,12aS,13S,16S,19S,22S,28S,31R,34S,37S,40S,46S,52S,55S,58S,61R,67S,70S,73R,76S,79S,82S,88S,91S,94R,97S)-34-(4-aminobutyl)-40-(2-amino-2-oxoethyl)-58-benzyl-82-[(2S)-butan-2-yl]-16,37,76-tris(3-carbamimidamidopropyl)-10,13,22,46-tetrakis(carboxymethyl)-4,55,70,97-tetrakis[(1R)-1-hydroxyethyl]-3a,19-bis(hydroxymethyl)-a-[(4-hydroxyphenyl)methyl]-6a,9a-dimethyl-12a,28-bis(2-methylpropyl)-1a,2,4a,5,7a,8,10a,11,13a,14,16a,17,20,23,26,29,32,35,38,41,44,47,53,56,59,62,65,68,71,74,77,80,83,89,92,95,98-heptatriacontaoxo-79,91-di(propan-2-yl)-19a,20a,23a,24a,27a,28a-hexathia-2a,3,5a,6,8a,9,11a,12,14a,15,17a,18,21,24,27,30,33,36,39,42,45,48,54,57,60,63,66,69,72,75,78,81,84,90,93,96,99-heptatriacontazahexacyclo[59.56.4.47,73.431,94.048,52.084,88]nonacosahectan-67-yl]propanoic acid
Synonyms
cyclo[Ala-Ala-Leu-Gly-Cys(1)-Thr-Cys(2)-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys(3)-Lys-Arg-Asn-Gly-Asp-Pro-Thr-Phe-Cys(1)-Gly-Glu-Thr-Cys(2)-Arg-Val-Ile-Pro-Val-Cys(3)-Thr-Tyr-Ser]; (cyclo)-AALGC(1)TC(2)DDRSDGLC(3)KRNGDPTFC(1)GETC(2)RVIPVC(3)TYS-(cyclo); cyclo[L-alanyl-L-alanyl-L-leucyl-glycyl-L-cysteinyl-L-threonyl-L-cysteinyl-L-alpha-aspartyl-L-alpha-aspartyl-L-arginyl-L-seryl-L-alpha-aspartyl-glycyl-L-leucyl-L-cysteinyl-L-lysyl-L-arginyl-L-asparagyl-glycyl-L-alpha-aspartyl-L-prolyl-L-threonyl-L-phenylalanyl-L-cysteinyl-glycyl-L-alpha-glutamyl-L-threonyl-L-cysteinyl-L-arginyl-L-valyl-L-isoleucyl-L-prolyl-L-valyl-L-cysteinyl-L-threonyl-L-tyrosyl-L-seryl] (5->24),(7->28),(15->34)-tris(disulfide)
Appearance
Lyophilized Powder
Purity
>85%
Sequence
cyclo{GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN} (Disulfide bridge: Cys6-Cys24, Cys10-Cys26, Cys16-Cys34)
Storage
Store at -20°C
Solubility
Soluble in Methanol
InChI
InChI=1S/C159H248N48O55S6/c1-17-73(10)119-156(262)207-47-27-35-106(207)147(253)200-117(71(6)7)149(255)196-104-68-268-265-65-101-142(248)183-83(30-21-22-42-160)130(236)181-84(31-23-43-168-157(162)163)131(237)186-92(52-107(161)215)127(233)172-59-110(218)179-96(56-116(228)229)155(261)206-46-26-34-105(206)148(254)205-123(79(16)213)152(258)190-90(50-80-28-19-18-20-29-80)137(243)194-99-63-263-264-64-100(180-111(219)60-171-126(232)88(48-69(2)3)185-125(231)75(12)175-124(230)74(11)176-140(246)97(61-208)193-136(242)91(51-81-36-38-82(214)39-37-81)191-151(257)120(76(13)210)204-146(104)252)145(251)203-122(78(15)212)154(260)198-103(67-267-266-66-102(143(249)184-86(33-25-45-170-159(166)167)133(239)199-118(72(8)9)150(256)201-119)197-153(259)121(77(14)211)202-134(240)87(40-41-112(220)221)177-108(216)57-174-129(99)235)144(250)189-95(55-115(226)227)139(245)188-94(54-114(224)225)138(244)182-85(32-24-44-169-158(164)165)132(238)192-98(62-209)141(247)187-93(53-113(222)223)128(234)173-58-109(217)178-89(49-70(4)5)135(241)195-101/h18-20,28-29,36-39,69-79,83-106,117-123,208-214H,17,21-27,30-35,40-68,160H2,1-16H3,(H2,161,215)(H,171,232)(H,172,233)(H,173,234)(H,174,235)(H,175,230)(H,176,246)(H,177,216)(H,178,217)(H,179,218)(H,180,219)(H,181,236)(H,182,244)(H,183,248)(H,184,249)(H,185,231)(H,186,237)(H,187,247)(H,188,245)(H,189,250)(H,190,258)(H,191,257)(H,192,238)(H,193,242)(H,194,243)(H,195,241)(H,196,255)(H,197,259)(H,198,260)(H,199,239)(H,200,253)(H,201,256)(H,202,240)(H,203,251)(H,204,252)(H,205,254)(H,220,221)(H,222,223)(H,224,225)(H,226,227)(H,228,229)(H4,162,163,168)(H4,164,165,169)(H4,166,167,170)/t73-,74-,75-,76+,77+,78+,79+,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,117-,118-,119-,120-,121-,122-,123-/m0/s1
InChI Key
CFRTULIKXDWFLG-AGMMIYIUSA-N
Canonical SMILES
CCC(C)C1C(=O)N2CCCC2C(=O)NC(C(=O)NC3CSSCC4C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)N5CCCC5C(=O)NC(C(=O)NC(C(=O)NC6CSSCC(C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)C)CCCNC(=N)N)NC(=O)C(NC(=O)C(NC(=O)CNC6=O)CCC(=O)O)C(C)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)N4)CC(C)C)CC(=O)O)CO)CCCNC(=N)N)CC(=O)O)CC(=O)O)C(C)O)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC3=O)C(C)O)CC7=CC=C(C=C7)O)CO)C)C)CC(C)C)CC8=CC=CC=C8)C(C)O)CC(=O)O)CC(=O)N)CCCNC(=N)N)CCCCN)C(C)C
1. Solution structure of the cyclotide palicourein: implications for the development of a pharmaceutical framework
Daniel G Barry, Norelle L Daly, Heidi R Bokesch, Kirk R Gustafson, David J Craik Structure. 2004 Jan;12(1):85-94. doi: 10.1016/j.str.2003.11.019.
The cyclotides are a family of disulfide-rich proteins from plants. They have the characteristic structural features of a circular protein backbone and a knotted arrangement of disulfide bonds. Structural and biochemical studies of the cyclotides suggest that their unique physiological stability can be loaned to bioactive peptide fragments for pharmaceutical and agricultural development. In particular, the cyclotides incorporate a number of solvent-exposed loops that are potentially suitable for epitope grafting applications. Here, we determine the structure of the largest known cyclotide, palicourein, which has an atypical size and composition within one of the surface-exposed loops. The structural data show that an increase in size of a palicourein loop does not perturb the core fold, to which the thermodynamic and chemical stability has been attributed. The cyclotide core fold, thus, can in principle be used as a framework for the development of useful pharmaceutical and agricultural bioactivities.
2. A novel anti-HIV macrocyclic peptide from Palicourea condensata
H R Bokesch, L K Pannell, P K Cochran, R C Sowder 2nd, T C McKee, M R Boyd J Nat Prod. 2001 Feb;64(2):249-50. doi: 10.1021/np000372l.
A 37 amino acid cyclic polypeptide has been isolated from the organic extract of the tropical tree Palicourea condensata. Palicourein (1) is the largest of a growing family of plant peptides that contain a cyclized amino acid backbone cross-linked via three internal disulfide bridges. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 microM and an IC50 value of 1.5 microM.
Online Inquiry
Verification code
Inquiry Basket