Peptide YY (3-36) (BAT-006172)
* For research use only

Peptide YY (3-36) is a Y2/Y5 Neuropeptide Y receptor agonist (IC50= 0.11 nM for inhibition of 125I-PYY binding to Y2 receptor). Human peptide YY (PYY) has roles in energy homeostasis, food ingestion, gut motility and insulin secretion.

Category
Peptide Inhibitors
Catalog number
BAT-006172
CAS number
126339-09-1
Molecular Formula
C176H272N52O54
Molecular Weight
3980.4
Peptide YY (3-36)
Ordering Information
Catalog Number Size Price Stock Quantity
BAT-006172 5 mg $288 In stock
Add to cart
Synonyms
Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Purity
98%
Sequence
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Storage
Store in a cool and dry place (or refer to the Certificate of Analysis).
InChI Key
AIYOBVCUSVSXOL-NYGOYQSZSA-N
Bio Calculators
Stock concentration: *
Desired final volume: *
Desired concentration: *

L

* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2

* Total Molecular Weight:
g/mol
Tip: Chemical formula is case sensitive. C22H30N4O c22h30n40
g/mol
g
Related Products
Quick Inquiry
Verification code
Inquiry Basket