Need Assistance?

US & Canada:
+
UK: +

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

Peptide YY (canine, mouse, porcine, rat)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Peptide YY (canine, mouse, porcine, rat) is the synthetic peptide analogue of Peptide YY, astutely tailored for utilization within the researchs of canine, mouse, porcine and rat models.

Category

Functional Peptides

Catalog number

BAT-015182

CAS number

81858-94-8

Molecular Formula

C190H288N54O57

Molecular Weight

4240.71

Specification
Reference Reading

IUPAC Name

(4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]carbamoyl]pyrrolidin-1-yl]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-[[2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-2-[[(2S)-1-[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]propanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-4-carboxybutanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-5-oxopentanoic acid

Synonyms

PYY (canine, mouse, porcine, rat); H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2; L-tyrosyl-L-prolyl-L-alanyl-L-lysyl-L-prolyl-L-alpha-glutamyl-L-alanyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-tyrosyl-L-tyrosyl-L-alanyl-L-seryl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-leucyl-L-asparagyl-L-leucyl-L-valyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide

Appearance

White Powder

Purity

≥95%

Sequence

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Storage

Store at -20°C

Solubility

Soluble in Water

InChI

InChI=1S/C190H288N54O57/c1-92(2)74-125(167(282)217-115(28-19-67-206-188(198)199)160(275)233-132(83-107-86-204-91-210-107)172(287)232-131(82-106-43-53-112(253)54-44-106)170(285)227-126(75-93(3)4)168(283)234-133(84-143(194)255)173(288)228-128(77-95(7)8)174(289)239-150(96(9)10)181(296)240-151(101(15)248)182(297)223-117(30-21-69-208-190(202)203)157(272)219-119(55-60-142(193)254)162(277)216-114(27-18-66-205-187(196)197)158(273)225-124(152(195)267)79-103-37-47-109(250)48-38-103)229-176(291)135(88-245)236-154(269)97(11)211-165(280)129(80-104-39-49-110(251)50-40-104)231-171(286)130(81-105-41-51-111(252)52-42-105)230-159(274)116(29-20-68-207-189(200)201)218-175(290)136(89-246)237-169(284)127(76-94(5)6)226-164(279)121(58-63-147(261)262)220-163(278)122(59-64-148(263)264)222-180(295)141-34-25-73-244(141)186(301)137(90-247)238-155(270)98(12)212-166(281)134(85-149(265)266)235-161(276)118(56-61-145(257)258)215-144(256)87-209-177(292)138-31-22-70-241(138)183(298)100(14)214-156(271)120(57-62-146(259)260)221-179(294)140-33-24-72-243(140)185(300)123(26-16-17-65-191)224-153(268)99(13)213-178(293)139-32-23-71-242(139)184(299)113(192)78-102-35-45-108(249)46-36-102/h35-54,86,91-101,113-141,150-151,245-253H,16-34,55-85,87-90,191-192H2,1-15H3,(H2,193,254)(H2,194,255)(H2,195,267)(H,204,210)(H,209,292)(H,211,280)(H,212,281)(H,213,293)(H,214,271)(H,215,256)(H,216,277)(H,217,282)(H,218,290)(H,219,272)(H,220,278)(H,221,294)(H,222,295)(H,223,297)(H,224,268)(H,225,273)(H,226,279)(H,227,285)(H,228,288)(H,229,291)(H,230,274)(H,231,286)(H,232,287)(H,233,275)(H,234,283)(H,235,276)(H,236,269)(H,237,284)(H,238,270)(H,239,289)(H,240,296)(H,257,258)(H,259,260)(H,261,262)(H,263,264)(H,265,266)(H4,196,197,205)(H4,198,199,206)(H4,200,201,207)(H4,202,203,208)/t97-,98-,99-,100-,101+,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,150-,151-/m0/s1

InChI Key

DVSSIQOSVMXRLH-HDTKZREISA-N

Canonical SMILES

CC(C)CC(C(=O)NC(CO)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC1=CC=C(C=C1)O)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)NC(C)C(=O)NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC3=CN=CN3)C(=O)NC(CC4=CC=C(C=C4)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)NC(CCC(=O)N)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC5=CC=C(C=C5)O)C(=O)N)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C6CCCN6C(=O)C(CO)NC(=O)C(C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C7CCCN7C(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C8CCCN8C(=O)C(CCCCN)NC(=O)C(C)NC(=O)C9CCCN9C(=O)C(CC1=CC=C(C=C1)O)N

1. Peptide YY in the mammalian pancreas: immunocytochemical localization and immunochemical characterization

R Håkanson, F Sundler, G Böttcher, R Ekman, J Sjöberg Regul Pept . 1993 Feb 18;43(3):115-30. doi: 10.1016/0167-0115(93)90146-y.

Peptide YY (PYY) was demonstrated by immunochemical and/or immunocytochemical methods in endocrine cells in the pancreas of adult mice, rats, guinea-pigs, cats, dogs, pigs and cows. In the pancreas of mouse and rat, immunoreactive PYY was observed in a major subpopulation of the glucagon cells (splenic lobe of the pancreas); immunoreactive PYY also occurred in a subpopulation of the pancreatic polypeptide (PP) cells (duodenal lobe), and in a few extra-insular endocrine cells dispersed throughout the pancreatic parenchyma. In the pancreas of cat, dog and pig immunoreactive PYY was found to coexist with PP, but not with glucagon. Radioimmunoassay (RIA) revealed PYY-like material in extracts of pancreas (and colon) of all the species examined. The highest concentrations were found in the pancreas of cat and mouse; moderate amounts were found in the rat and only small amounts were detected in guinea-pig and pig. The concentrations in the pancreas were uniformly much lower than those in the colon. Analysis by high performance liquid chromatography (HPLC) showed that the PYY-immunoreactive material from pancreas (and rat colon) had an elution profile very similar to that of synthetic PYY, and distinct from that of PP and neuropeptide Y.

2. Molecular biology and pharmacology of multiple NPY Y5 receptor species homologs

C Gerald, T A Branchek, M W Walker, R L Weinshank, J Bard, P Vaysse, T M Laz, B Borowsky Regul Pept . 1998 Sep 25;75-76:45-53. doi: 10.1016/s0167-0115(98)00052-4.

NPY is a 36-amino acid peptide which exerts its physiological effects through the activation of a family of G-protein coupled receptors. In vivo and in vitro characterization of the recently cloned rat Y5 receptor suggests that it is a primary mediator of NPY-induced feeding (Gerald et al., Nature 1996;382:168-171). We now report the molecular cloning and pharmacological characterization of the human, dog and mouse homologs of the Y5 receptor. With the exception of a 21 amino acid repeat in the amino terminus of the mouse Y5 receptor, the sequence of the four species homologs appear to be highly conserved, with 88% to 97% amino acid identities between any two species. Similarly, the pharmacological profiles of the four species homologs as determined in porcine 125I-PYY binding assays show a great deal of conservation, with the following rank order of affinity: human or porcine NPY, PYY, [Leu31,Pro34]NPY, NPY(2-36), human PP > human [D-Trp32]NPY > rat PP, C2-NPY. Northern blot analysis reveals that the Y5 receptor is widely distributed in the human brain, with the strongest signals detected in the cortex, putamen and caudate nucleus. The chromosomal localization of the human Y5 receptor, previously shown to be overlapping and in the opposite orientation to the Y1 receptor, is determined to be 4q31, the same locus as previously demonstrated for the human Y1 receptor (Herzog et al., J Biol Chem 1993;268:6703-6707), suggesting that these receptors may be coregulated. These Y5 species homologs along with corresponding animal models may be useful in the search for novel therapeutics in the treatment of obesity and related feeding disorders.

3. Islet amyloid polypeptide in the gut and pancreas: localization, ontogeny and gut motility effects

F Sundler, M Ekelund, H Mulder, E Ekblad Peptides . 1997;18(6):771-83. doi: 10.1016/s0196-9781(97)00008-9.

The occurrence of islet amyloid polypeptide (IAPP) in the gut and pancreas of several species and during ontogeny of the rat, was studied using immunocytochemistry. Effects of IAPP on rat ileal smooth muscle were assessed in vitro. Islets of most, but not all, species examined, displayed IAPP in insulin cells and, in some species, also in somatostatin- and peptide YY (PYY)-containing cells. In the gut, expression of IAPP varied among species; when present, IAPP was most abundant in the proximal part and co-localized with somatostatin, PYY, gastrin/cholecystokinin, enteroglucagon or serotonin. IAPP was first demonstrated at embryonic day 12 and 16 in islet and gastrointestinal endocrine cells, respectively. IAPP relaxed gut muscle and reduced electrical field stimulation-evoked contractions, presumably by inhibiting acetylcholine release. Thus, IAPP expression in islets is consistent with an important role for IAPP in fuel metabolism; the gastrointestinal expression and motor effects of IAPP suggest that IAPP may modulate gastrointestinal function.