webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Need Assistance?
  • US & Canada:
    +
  • UK: +

Plantaricin C19

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Plantaricin C19 is an antimicrobial peptide and an anti-Listeria bacteriocin found in Lactobacillus plantarum C19, and has antibacterial activity.

Category
Functional Peptides
Catalog number
BAT-011537
CAS number
153858-63-0
Purity
>98%
Sequence
KYYGNGLSCSKKGCTVNWGQAFSCGVNRVATAGHGK
Storage
Store at -20°C
1. Mode of action, purification and amino acid sequence of plantaricin C19, an anti-Listeria bacteriocin produced by Lactobacillus plantarum C19
A Atrih, N Rekhif, A J Moir, A Lebrihi, G Lefebvre Int J Food Microbiol. 2001 Aug 15;68(1-2):93-104. doi: 10.1016/s0168-1605(01)00482-2.
Plantaricin C19, an anti-Listeria bacteriocin, was successfully purified by adsorption to and release from producing cells at low pH combined with reverse phase high-performance liquid chromatography (HPLC). The purification resulted in a 900-fold increase in specific activity with a yield of 15% of the original activity. Mass spectrometry analysis gave a molecular weight of 3845.3. Protein microsequencing identified 36 amino acids. Plantaricin C19 is rich in both hydrophobic and basic amino acids in good accordance with its basic and hydrophobic character. Comparison of the amino acid sequence of plantaricin C19, with the sequence of some other anti-Listeria bacteriocins produced with lactic acid bacteria, revealed that plantaricin C19 has in its N-terminal region the consensus sequence--YYGNGL--(uniquely with Valine instead of Leucine as found in all other bacteriocins), identifying plantaricin C19 as a pediocin-like bacteriocin. Plantaricin C19 exerted a bacteriostatic action on sensitive cells of Listeria grayi IP 6818 in BHI broth. No loss of intracellular K+, Mg2+ or UV-absorbing materials was observed. Adsorption of plantaricin C19 on L. grayi CIP 6818 decreased in the presence of salts.
2. Bacteriocins of Lactobacillus plantarum strains from fermented foods
N A Olasupo Folia Microbiol (Praha). 1996;41(2):130-6. doi: 10.1007/BF02814687.
Bacteriocin-producing strains may be used as protective cultures to improve the microbial safety of foods. The crude or purified form of these antimicrobial agents may also be applied directly as food preservative. This review gives survey of the different bacteriocins produced by Lactobacillus plantarum isolated from fermented food products with particular emphasis on their genetic and biochemical properties. A number of bacteriocins are produced by L. plantarum. These include plantaricin B, plantaricin BN, plantaricin A, plantaricin C, plantaricin S and T, plantaricin F, plantaricin C19 and SA6 and other unnamed bacteriocins. However, with the exception of plantaricin A, information on the genetic and biochemical characteristics of L. plantarum bacteriocins is still scant.
Online Inquiry
Inquiry Basket