webinar
August 17–21, 2025, Washington, DC, USA - Visit us at Booth 2230.
Read More
Need Assistance?
  • US & Canada:
    +
  • UK: +

Seminalplasmin

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Seminalplasmin is an antibacterial peptide isolated from Bovine Bos taurus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi.

Category
Functional Peptides
Catalog number
BAT-011135
CAS number
147958-06-3
Molecular Formula
C76H123N17O16
Molecular Weight
1530.9
IUPAC Name
2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-pyrrolidine-2-carbonyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-3-methylpentanoyl]amino]acetic acid
Synonyms
Ser-Asp-Glu-Lys-Ala-Ser-Pro-Asp-Lys-His-His-Arg-Phe-Ser-Leu-Ser-Arg-Tyr-Ala-Lys-Leu-Ala-Asn-Arg-Leu-Ala-Asn-Pro-Lys-Leu-Leu-Glu-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-Asp-Arg-Gly-Asn-Arg-Ser-Val
Sequence
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV
InChI
InChI=1S/C76H123N17O16/c1-10-46(8)63(75(108)82-41-62(96)97)92-73(106)60(39-49-40-81-51-26-15-14-25-50(49)51)89-67(100)54(28-17-20-32-78)85-74(107)61(42-94)91-71(104)58(37-45(6)7)88-72(105)59(38-48-23-12-11-13-24-48)90-76(109)64(47(9)95)93-68(101)55(29-18-21-33-79)84-69(102)56(35-43(2)3)87-70(103)57(36-44(4)5)86-66(99)53(27-16-19-31-77)83-65(98)52-30-22-34-80-52/h11-15,23-26,40,43-47,52-61,63-64,80-81,94-95H,10,16-22,27-39,41-42,77-79H2,1-9H3,(H,82,108)(H,83,98)(H,84,102)(H,85,107)(H,86,99)(H,87,103)(H,88,105)(H,89,100)(H,90,109)(H,91,104)(H,92,106)(H,93,101)(H,96,97)/t46-,47+,52-,53-,54-,55-,56-,57-,58-,59-,60-,61-,63-,64-/m0/s1
InChI Key
MEHAQQQARFSCCN-TZBWDYHDSA-N
Canonical SMILES
CCC(C)C(C(=O)NCC(=O)O)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(C(C)O)NC(=O)C(CCCCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C4CCCN4
1. Seminalplasmin, the major basic protein of bull seminal plasma, is a secretory protein of the seminal vesicles
F Wempe, S Wagner, H vd Kammer, E Krauhs, K H Scheit Biochim Biophys Acta. 1990 Jun 20;1034(3):260-2. doi: 10.1016/0304-4165(90)90047-z.
From the experimental results of three independent methods: (1) indirect immunofluorescence employing monospecific anti-seminalplasmin-IgGs, (2) cell-free translation of poly(A)+ RNA from seminal vesicle and testicular tissue, as well as (3) Northern analysis of poly(A)+ RNA of the latter tissues with a synthetic seminalplasmin-specific antisense DNA probe, it is concluded that the biosynthesis of seminalplasmin occurs in seminal vesicles but not in testis.
2. Seminalplasmin. An endogenous calmodulin antagonist
K Gietzen, H J Galla Biochem J. 1985 Aug 15;230(1):277-80. doi: 10.1042/bj2300277.
Seminalplasmin, a strongly basic protein isolated from bull semen, was found to antagonize with high potency and extraordinary specificity the function of calmodulin. Calmodulin antagonism is the result of an interaction between the two proteins, which is mainly determined by electrostatic forces. The stimulation of Ca2+-transporting ATPase and phosphodiesterase by calmodulin was half-maximally inhibited at approx. 0.1 microM-seminalplasmin. However, the basal activity of calmodulin-dependent enzymes was not significantly altered by seminalplasmin over the concentration range investigated.
3. Seminalplasmin and caltrin are the same protein
N Sitaram, V K Kumari, P M Bhargava FEBS Lett. 1986 Jun 9;201(2):233-6. doi: 10.1016/0014-5793(86)80615-9.
The sequence of seminalplasmin, a basic antimicrobial and transcription-inhibitory protein from bovine seminal plasma, has been determined using an automated sequenator. This sequence is slightly different from that reported earlier by Theil and Scheit [(1983) EMBO J. 2, 1159-1163] and identical with that of caltrin, a Ca2+-transport-inhibitory protein of bovine seminal plasma. Caltrin and seminalplasmin are, therefore, the same protein.
Online Inquiry
Inquiry Basket