Need Assistance?

US & Canada:
+
UK: +

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

Seminalplasmin

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Seminalplasmin is an antibacterial peptide isolated from Bovine Bos taurus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi.

Category

Functional Peptides

Catalog number

BAT-011135

CAS number

147958-06-3

Molecular Formula

C76H123N17O16

Molecular Weight

1530.9

Specification
Reference Reading

IUPAC Name

2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-pyrrolidine-2-carbonyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]amino]-3-hydroxybutanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-3-methylpentanoyl]amino]acetic acid

Synonyms

Ser-Asp-Glu-Lys-Ala-Ser-Pro-Asp-Lys-His-His-Arg-Phe-Ser-Leu-Ser-Arg-Tyr-Ala-Lys-Leu-Ala-Asn-Arg-Leu-Ala-Asn-Pro-Lys-Leu-Leu-Glu-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-Asp-Arg-Gly-Asn-Arg-Ser-Val

Sequence

SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV

InChI

InChI=1S/C76H123N17O16/c1-10-46(8)63(75(108)82-41-62(96)97)92-73(106)60(39-49-40-81-51-26-15-14-25-50(49)51)89-67(100)54(28-17-20-32-78)85-74(107)61(42-94)91-71(104)58(37-45(6)7)88-72(105)59(38-48-23-12-11-13-24-48)90-76(109)64(47(9)95)93-68(101)55(29-18-21-33-79)84-69(102)56(35-43(2)3)87-70(103)57(36-44(4)5)86-66(99)53(27-16-19-31-77)83-65(98)52-30-22-34-80-52/h11-15,23-26,40,43-47,52-61,63-64,80-81,94-95H,10,16-22,27-39,41-42,77-79H2,1-9H3,(H,82,108)(H,83,98)(H,84,102)(H,85,107)(H,86,99)(H,87,103)(H,88,105)(H,89,100)(H,90,109)(H,91,104)(H,92,106)(H,93,101)(H,96,97)/t46-,47+,52-,53-,54-,55-,56-,57-,58-,59-,60-,61-,63-,64-/m0/s1

InChI Key

MEHAQQQARFSCCN-TZBWDYHDSA-N

Canonical SMILES

CCC(C)C(C(=O)NCC(=O)O)NC(=O)C(CC1=CNC2=CC=CC=C21)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC3=CC=CC=C3)NC(=O)C(C(C)O)NC(=O)C(CCCCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C4CCCN4

1. Seminalplasmin, the major basic protein of bull seminal plasma, is a secretory protein of the seminal vesicles

F Wempe, S Wagner, H vd Kammer, E Krauhs, K H Scheit Biochim Biophys Acta. 1990 Jun 20;1034(3):260-2. doi: 10.1016/0304-4165(90)90047-z.

From the experimental results of three independent methods: (1) indirect immunofluorescence employing monospecific anti-seminalplasmin-IgGs, (2) cell-free translation of poly(A)+ RNA from seminal vesicle and testicular tissue, as well as (3) Northern analysis of poly(A)+ RNA of the latter tissues with a synthetic seminalplasmin-specific antisense DNA probe, it is concluded that the biosynthesis of seminalplasmin occurs in seminal vesicles but not in testis.

2. Seminalplasmin. An endogenous calmodulin antagonist

K Gietzen, H J Galla Biochem J. 1985 Aug 15;230(1):277-80. doi: 10.1042/bj2300277.

Seminalplasmin, a strongly basic protein isolated from bull semen, was found to antagonize with high potency and extraordinary specificity the function of calmodulin. Calmodulin antagonism is the result of an interaction between the two proteins, which is mainly determined by electrostatic forces. The stimulation of Ca2+-transporting ATPase and phosphodiesterase by calmodulin was half-maximally inhibited at approx. 0.1 microM-seminalplasmin. However, the basal activity of calmodulin-dependent enzymes was not significantly altered by seminalplasmin over the concentration range investigated.

3. Seminalplasmin and caltrin are the same protein

N Sitaram, V K Kumari, P M Bhargava FEBS Lett. 1986 Jun 9;201(2):233-6. doi: 10.1016/0014-5793(86)80615-9.

The sequence of seminalplasmin, a basic antimicrobial and transcription-inhibitory protein from bovine seminal plasma, has been determined using an automated sequenator. This sequence is slightly different from that reported earlier by Theil and Scheit [(1983) EMBO J. 2, 1159-1163] and identical with that of caltrin, a Ca2+-transport-inhibitory protein of bovine seminal plasma. Caltrin and seminalplasmin are, therefore, the same protein.