Need Assistance?

  • US & Canada:
    +
  • UK: +
T07C4.4
* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

T07C4.4 is an antibacterial peptide isolated from Leptodactylus syphax.

Category
Functional Peptides
Catalog number
BAT-010917
Synonyms
Met-Thr-Arg-Ile-Leu-Pro-Cys-Leu-Phe-Leu-Val-Leu-Leu-Ala-Ala-Ala-Pro-Leu-Leu-Ala-Asn-Pro-Ala-Asn-Pro-Leu-Asn-Leu-Lys-Lys-His-His-Gly-Val-Phe
Purity
>97%
Sequence
MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF

Online Inquiry

Verification code
Inquiry Basket