Inquiry Basket
T07C4.4 is an antibacterial peptide isolated from Leptodactylus syphax.
Synonyms | |
---|---|
Synonyms | Met-Thr-Arg-Ile-Leu-Pro-Cys-Leu-Phe-Leu-Val-Leu-Leu-Ala-Ala-Ala-Pro-Leu-Leu-Ala-Asn-Pro-Ala-Asn-Pro-Leu-Asn-Leu-Lys-Lys-His-His-Gly-Val-Phe |
Purity | |
Purity | >97% |
Sequence | |
Sequence | MTRILPCLFLVLLAAAPLLANPANPLNLKKHHGVF |
* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2
Three to One Letter Converter: Pull down the menu to view the 3 to 1 conversion.
Enter Peptide Sequence in Box (use one letter code)
Length: Residues
Molecular Weight: g/mol
Molecular formula: