Tat-Beclin-1

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that triggers cell adaptation, survival, or death. When combined with the cell-permeable peptide, it can successfully enter cells and induce autophagy.

Category
Functional Peptides
Catalog number
BAT-013298
Molecular Formula
C164H251N57O45
Molecular Weight
3741.15
Synonyms
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH; Tat-BECN1
Appearance
Lyophilized Solid
Purity
≥95%
Sequence
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Storage
Store at -20°C
Bio Calculators
Stock concentration: *
Desired final volume: *
Desired concentration: *

L

* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2

* Total Molecular Weight:
g/mol
Tip: Chemical formula is case sensitive. C22H30N4O c22h30n40
g/mol
g

Three to One Letter Converter: Pull down the menu to view the 3 to 1 conversion.

Enter Peptide Sequence in Box (use one letter code)

Length: Residues

Molecular Weight: g/mol

Molecular formula:
Three letter code:
Related Products
Quick Inquiry
Verification code
Upcoming Events
Inquiry Basket