TAT-HA2 Fusion Peptide

It is a cell penetrating peptide consisting of amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2), which is linked to a 10 amino acid cell permeable HIV Trans-activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 can be used as a large molecule drug delivery peptide. TAT PTD binds to the cell surface and penetrates the cell membrane through lipid raft dependent macropinocytosis. The HA2 domain is a pH-sensitive lipid membrane destabilizing sequence that enhances endosomal escape and transduction of the fusion peptide.

Category
Functional Peptides
Catalog number
BAT-013287
Molecular Formula
C149H243N53O39S
Molecular Weight
3432.98
Synonyms
H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH
Appearance
Lyophilized Solid
Purity
≥95%
Sequence
RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Storage
Store at -20°C
Bio Calculators
Stock concentration: *
Desired final volume: *
Desired concentration: *

L

* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2

* Total Molecular Weight:
g/mol
Tip: Chemical formula is case sensitive. C22H30N4O c22h30n40
g/mol
g

Three to One Letter Converter: Pull down the menu to view the 3 to 1 conversion.

Enter Peptide Sequence in Box (use one letter code)

Length: Residues

Molecular Weight: g/mol

Molecular formula:
Three letter code:
Related Products
Quick Inquiry
Verification code
Upcoming Events
Inquiry Basket