TAT-NSF222 Fusion Peptide

This sequence is a N-ethylmaleimide sensitive factor (NSF) peptide that connects to the 11 amino acid cell permeable human immunodeficiency virus (HIV) transactivating regulatory protein (TAT) domain by Gly-Gly-Gly spacer. The peptide contains the NSF domain extending from 222 to 243 amino acids, which is located directly at the amino terminus of the Walker A motif in the NSF D1 domain. ATPase assay shows that TAT-NSF222 inhibits the activity of NSF ATPase.

Category
Functional Peptides
Catalog number
BAT-013288
Molecular Formula
C187H301N67O47
Molecular Weight
4239.89
Synonyms
H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Asp-Lys-Glu-Phe-Asn-Ser-Ile-Phe-Arg-Arg-Ala-Phe-Ala-Ser-Arg-Val-Phe-Pro-Pro-Glu-OH
Appearance
Lyophilized Solid
Purity
≥95%
Sequence
YGRKKRRQRRRGGGLDKEFNSIFRRAFASRVFPPE
Storage
Store at -20°C
Bio Calculators
Stock concentration: *
Desired final volume: *
Desired concentration: *

L

* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2

* Total Molecular Weight:
g/mol
Tip: Chemical formula is case sensitive. C22H30N4O c22h30n40
g/mol
g

Three to One Letter Converter: Pull down the menu to view the 3 to 1 conversion.

Enter Peptide Sequence in Box (use one letter code)

Length: Residues

Molecular Weight: g/mol

Molecular formula:
Three letter code:
Related Products
Quick Inquiry
Verification code
Upcoming Events
Inquiry Basket