Need Assistance?
  • US & Canada:
    +
  • UK: +

THP-1

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

THP-1 is an antibacterial peptide isolated from Meleagris gallopavo. It has activity against gram-positive bacteria.

Category
Functional Peptides
Catalog number
BAT-011377
Synonyms
Gly-Lys-Arg-Glu-Lys-Cys-Leu-Arg-Arg-Asn-Gly-Phe-Cys-Ala-Phe-Leu-Lys-Cys-Pro-Thr-Leu-Ser-Val-Ile-Ser-Gly-Thr-Cys-Ser-Arg-Phe-Gln-Val-Cys-Cys
Sequence
GKREKCLRRNGFCAFLKCPTLSVISGTCSRFQVCC
1. THP-1 cell line: an in vitro cell model for immune modulation approach
Wasaporn Chanput, Jurriaan J Mes, Harry J Wichers Int Immunopharmacol. 2014 Nov;23(1):37-45. doi: 10.1016/j.intimp.2014.08.002. Epub 2014 Aug 14.
THP-1 is a human leukemia monocytic cell line, which has been extensively used to study monocyte/macrophage functions, mechanisms, signaling pathways, and nutrient and drug transport. This cell line has become a common model to estimate modulation of monocyte and macrophage activities. This review attempts to summarize and discuss recent publications related to the THP-1 cell model. An overview on the biological similarities and dissimilarities between the THP-1 cell line and human peripheral blood mononuclear cell (PBMC) derived-monocytes and macrophages, as well as the advantages and disadvantages of the use of THP-1 cell line, is included. The review summarizes different published co-cultivation studies of THP-1 cells with other cell types, for instance, intestinal cells, adipocytes, T-lymphocytes, platelets, and vascular smooth muscle cells, which can be an option to study cell-cell interaction in vitro and can be an approach to better mimic in vivo conditions. Macrophage polarization is a relatively new topic which gains interest for which the THP-1 cell line also may be relevant. Besides that an overview of newly released commercial THP-1 engineered-reporter cells and THP-1 inflammasome test-cells is also given. Evaluation of recent papers leads to the conclusion that the THP-1 cell line has unique characteristics as a model to investigate/estimate immune-modulating effects of compounds in both activated and resting conditions of the cells. Although the THP-1 response can hint to potential responses that might occur ex vivo or in vivo, these should be, however, validated by in vivo studies to draw more definite conclusions.
2. Caffeine Inhibits NLRP3 Inflammasome Activation by Suppressing MAPK/NF-κB and A2aR Signaling in LPS-Induced THP-1 Macrophages
Weiming Zhao, Li Ma, Cheng Cai, Xiaohui Gong Int J Biol Sci. 2019 Jun 2;15(8):1571-1581. doi: 10.7150/ijbs.34211. eCollection 2019.
Excessive inflammation induced by various risk factors is associated with the development of bronchopulmonary dysplasia (BPD). Caffeine exerts potent anti-inflammatory effects as a clinical preventive medicine for BPD. Recently, NLRP3 inflammasome activation has been demonstrated to be essential for the pathogenesis of BPD. In the present study, we aimed to investigate the effects of caffeine on NLRP3 inflammasome activation in LPS-induced THP-1 macrophages and to explore the underlying the detailed mechanism. We found that caffeine significantly reduced NLRP3 expression, ASC speck formation, and caspase 1 cleavage and therefore decreased IL-1β and IL-18 secretion in THP-1 macrophages. Caffeine also markedly decreased the phosphorylation levels of MAPK and NF-κB pathway members, further suppressing the translocation of NF-κB in THP-1 macrophages. Moreover, silencing of the caffeine-antagonized adenosine A2a receptor (A2aR) significantly decreased cleaved caspase 1 expression in THP-1 macrophages by reducing ROS production. Given these findings, we conclude that caffeine inhibits NLRP3 inflammasome activation by suppressing MAPK/NF-κB signaling and A2aR-associated ROS production in LPS-induced THP-1 macrophages.
Online Inquiry
Inquiry Basket