Need Assistance?

US & Canada:
+
UK: +

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

Urotensin I

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Urotensin I is, 41-aa neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively.

Category

Peptide Inhibitors

Catalog number

BAT-010653

CAS number

83930-33-0

Molecular Formula

C210H340N62O67S2

Molecular Weight

4869.45

Specification
Reference Reading

IUPAC Name

(3S,5S)-3-[[(2R)-2-[(2S)-2-[[(2S,3S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-3-methyl-1-oxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carbonyl]amino]-5-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-oxoheptanedioic acid

Synonyms

Catostomus urotensin I

Sequence

NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV

Storage

Store at -20°C

InChI

InChI=1S/C210H340N62O67S2/c1-26-103(17)162(200(333)249-124(58-64-155(288)289)181(314)258-138(86-148(215)278)193(326)244-122(56-62-153(284)285)178(311)239-116(44-35-69-228-206(219)220)175(308)243-121(55-61-152(282)283)179(312)242-120(54-60-146(213)276)172(305)234-107(21)169(302)232-94-151(281)236-130(77-97(5)6)185(318)259-140(88-150(217)280)192(325)241-117(45-36-70-229-207(221)222)174(307)238-115(43-33-34-68-211)176(309)255-135(83-111-50-52-113(275)53-51-111)189(322)252-133(80-100(11)12)188(321)260-141(91-159(296)297)195(328)245-125(59-65-156(290)291)183(316)265-161(102(15)16)168(218)301)266-182(315)119(47-38-72-231-209(225)226)237-170(303)108(22)235-173(306)126(66-75-340-24)246-180(313)123(57-63-154(286)287)248-201(334)163(104(18)27-2)267-184(317)127(67-76-341-25)247-194(327)139(87-149(216)279)257-177(310)118(46-37-71-230-208(223)224)240-186(319)131(78-98(7)8)251-187(320)132(79-99(9)10)253-191(324)137(84-112-93-227-96-233-112)256-190(323)136(82-110-41-31-30-32-42-110)261-204(337)166(109(23)274)270-197(330)134(81-101(13)14)254-196(329)142(92-160(298)299)262-202(335)164(105(19)28-3)268-198(331)143(95-273)263-203(336)165(106(20)29-4)269-199(332)144-48-39-73-271(144)205(338)145-49-40-74-272(145)210(339)264-129(90-158(294)295)167(300)128(89-157(292)293)250-171(304)114(212)85-147(214)277/h30-32,41-42,50-53,93,96-109,114-145,161-166,273-275H,26-29,33-40,43-49,54-92,94-95,211-212H2,1-25H3,(H2,213,276)(H2,214,277)(H2,215,278)(H2,216,279)(H2,217,280)(H2,218,301)(H,227,233)(H,232,302)(H,234,305)(H,235,306)(H,236,281)(H,237,303)(H,238,307)(H,239,311)(H,240,319)(H,241,325)(H,242,312)(H,243,308)(H,244,326)(H,245,328)(H,246,313)(H,247,327)(H,248,334)(H,249,333)(H,250,304)(H,251,320)(H,252,322)(H,253,324)(H,254,329)(H,255,309)(H,256,323)(H,257,310)(H,258,314)(H,259,318)(H,260,321)(H,261,337)(H,262,335)(H,263,336)(H,264,339)(H,265,316)(H,266,315)(H,267,317)(H,268,331)(H,269,332)(H,270,330)(H,282,283)(H,284,285)(H,286,287)(H,288,289)(H,290,291)(H,292,293)(H,294,295)(H,296,297)(H,298,299)(H4,219,220,228)(H4,221,222,229)(H4,223,224,230)(H4,225,226,231)/t103-,104-,105-,106-,107-,108-,109+,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145+,161-,162-,163-,164-,165-,166-/m0/s1

InChI Key

YIHRBRJTFIGRRV-FJGLSHCJSA-N

Canonical SMILES

CCC(C)C(C(=O)NC(CO)C(=O)NC(C(C)CC)C(=O)NC(CC(=O)O)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(CC1=CC=CC=C1)C(=O)NC(CC2=CNC=N2)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC(=O)N)C(=O)NC(CCSC)C(=O)NC(C(C)CC)C(=O)NC(CCC(=O)O)C(=O)NC(CCSC)C(=O)NC(C)C(=O)NC(CCCN=C(N)N)C(=O)NC(C(C)CC)C(=O)NC(CCC(=O)O)C(=O)NC(CC(=O)N)C(=O)NC(CCC(=O)O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CCC(=O)O)C(=O)NC(CCC(=O)N)C(=O)NC(C)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CCCN=C(N)N)C(=O)NC(CCCCN)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)NC(CC(C)C)C(=O)NC(CC(=O)O)C(=O)NC(CCC(=O)O)C(=O)NC(C(C)C)C(=O)N)NC(=O)C4CCCN4C(=O)C5CCCN5C(=O)NC(CC(=O)O)C(=O)C(CC(=O)O)NC(=O)C(CC(=O)N)N

1. Physiological roles of urocortins, human homologues of fish urotensin I, and their receptors

Kazunori Kageyama, Takeshi Nigawara, Toshihiro Suda, Satoru Sakihara Peptides . 2004 Oct;25(10):1689-701. doi: 10.1016/j.peptides.2004.03.027.

Urocortin 1, a human homologue of fish urotensin I, together with its related-compounds (urocortins 2 and 3), comprises a distinct family of stress peptides. Urocortin 1 has a high affinity for both corticotropin-releasing factor (CRF) type 1 receptor (CRF1) and CRF type 2 receptor (CRF2), and urocortins 2 and 3 have a high affinity for CRF2, while CRF has a low affinity for CRF2 and a high affinity for CRF1. These differences of the binding affinity with receptors make the biological actions of these peptides. Besides the binding affinity with receptors, the limited overlap of the distribution of CRF and urocortins may also contribute to the differences of physiological roles of each peptide. Urocortins show 'stress-coping' responses such as anxiolysis and dearousal in the brain. In the periphery, recent studies show the potent effects of urocortins on the cardiovascular and immune systems. In this review article, we take a look over the series of peptides included in this family, especially in terms of the versatility of biological actions, along with the various characters of the receptors.

2. Relationship of urotensin I induced vasodilatory action in rat thoracic aorta to Ca2+ regulation

H Itoh, K Lederis Can J Physiol Pharmacol . 1987 Mar;65(3):298-302. doi: 10.1139/y87-052.

The relaxant effects of the synthetic fish neuropeptide urotensin I were examined in helical strips of rat aorta. In K+-depolarized aorta strips, urotensin I and verapamil competitively inhibited Ca2+-induced contractions. Urotensin I relaxed, in a concentration-dependent manner, the contraction produced by the Ca2+ ionophore A23187, whereas verapamil had no effect on this contraction, even at a concentration of 10(-5) M. In the absence and presence of extracellular Ca2+, urotensin I inhibited both components of the contractions elicited by norepinephrine or urotensin II, another fish neuropeptide. Verapamil reduced only the norepinephrine or urotensin II induced contraction in the presence of extracellular Ca2+, with little or no change in the contraction in Ca2+-free buffer. The urotensin I induced relaxation response in aortic strips contracted by 40 mM KCl was enhanced by pretreatment with papaverine or forskolin. Pretreatment with dibutyryl cAMP did not significantly alter the action of urotensin I. The presence or absence of endothelial cells did not change the response to urotensin I. These results suggest that urotensin I antagonizes the action and (or) mobilization of extracellular and intracellular Ca2+.

3. Urotensin I and its N-terminal flanking peptide from the flounder, Platichthys flesus

R J Balment, J M Conlon, D E Arnold-Reed Peptides . 1990 Sep-Oct;11(5):895-5. doi: 10.1016/0196-9781(90)90004-o.

The caudal spinal cord region of teleost fish terminates in a neurosecretory organ, the urophysis. Two peptides have been purified to homogeneity from an extract of the urophysis of a teleost fish, the flounder. The primary structure of one peptide, Ser-Glu-Asp-Pro-Pro-Met-Ser-Ile-Asp-Leu10-Thr-Phe-His-Met-Leu-Arg- Asn-Met-Ile- His20-Met-Ala-Lys-Met-Glu-Gly-Glu-Arg-Glu-Gln30-Ala-Gln-Ile- Asn-Arg-Asn-Leu-Leu - Asp-Glu40-Val, indicates identity with urotensin I. By analogy with other urotensins, the COOH-terminal residue is probably alpha-amidated. A second peptide was present in the extract in a concentration that was approximately equimolar with that of urotensin I. The amino acid composition of this peptide indicated a total of approximately 65 residues. The amino acid sequence of a fragment produced by digestion with trypsin was established as: Ala-Ala-Ala-Ala-Gly5-Asp-Ser-Ala-Ala-Ser10-Asp-Leu-Leu-Gly-Asp1 5-Asn-Ile-Leu- Arg. This sequence shows partial homology to carp prepro-urotensin I(41-59)-peptide as deduced from the nucleotide sequence of a cloned cDNA. It is concluded that the second peptide probably represents the N-terminal flanking peptide of pro-urotensin I which, it has previously been suggested, may function as a urotensin-binding peptide (urophysin) analogous to the neurophysins.