VrCRP

VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi.

Category
Functional Peptides
Catalog number
BAT-011046
Molecular Formula
C211H347N65O63S10
Molecular Weight
5123.07
Synonyms
Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys
Sequence
RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
Bio Calculators
Stock concentration: *
Desired final volume: *
Desired concentration: *

L

* Our calculator is based on the following equation:
Concentration (start) x Volume (start) = Concentration (final) x Volume (final)
It is commonly abbreviated as: C1V1 = C2V2

* Total Molecular Weight:
g/mol
Tip: Chemical formula is case sensitive. C22H30N4O c22h30n40
g/mol
g

Three to One Letter Converter: Pull down the menu to view the 3 to 1 conversion.

Enter Peptide Sequence in Box (use one letter code)

Length: Residues

Molecular Weight: g/mol

Molecular formula:
Three letter code:
Related Products
Quick Inquiry
Verification code
Upcoming Events
Inquiry Basket