Required fields are marked with *
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist.
CAT NO. : BAT-008949
CAT NO. : BAT-009108
CAT NO. : BAT-009157
CAT NO. : BAT-006145
CAT NO. : BAT-006144
CAT NO. : BAT-006226
Failed to load!
We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy