Peptides for Anticancer Research

Introduction to Cancer

Cancer is a general term for a large class of malignant tumors. Cancer cells are characterized by unrestricted and endless proliferation, which consumes a large amount of nutrients in the patient's body. Cancer cells release a variety of toxins, which can be transferred to all parts of the body to grow and reproduce, resulting in a series of symptoms such as weight loss, weakness, anemia, loss of appetite, fever, and severe organ damage. In contrast, there are benign tumors, which are easily removed and generally do not metastasize. Benign tumors can only squeeze and block the tissues and organs of the body, but cancers (malignant tumors) destroy the structure and function of tissues and organs. Cancer has become one of the most common lethal diseases.

Cancer cell - BOC Sciences

Cause of Cancer

Cancer is caused by the transformation of normal cells into uncontrolled abnormal cells by activation of proto-oncogenes by mutagens. The uncontrolled proliferation of abnormal cells produces new tissue that does not function as normal tissue. These proliferative tissues are also called tumors. Their main activity is to constantly consume the body's resources, occupying space and dividing and multiplying more and more quickly. Tumors can be divided into benign and malignant. Cancer generally refers to malignant tumors. Cancer cells will break away from malignant tumors and metastasize to other organs through the blood and lymphatic system, thereby forming new tumors and endangering life. The occurrence of cancer is closely related to genetics, environmental pollution, bad habits, dietary nutrition, viral infection and radiation.

Current Status of Cancer

Cancer is a major global public health problem and has become one of the most common lethal diseases. In the next 10 to 20 years, cancer may overtake cardiovascular disease as the leading cause of death globally. According to the World Health Organization's International Agency for Research on Cancer (IARC), the number of new cancer patients worldwide in 2020 will reach 19.29 million, and the number of deaths will be close to 10 million. The number of new cancer cases in the world is projected to reach 28.4 million by 2040. The top ten cancers in the world are breast cancer, lung cancer, colorectal cancer, prostate cancer, stomach cancer, liver cancer, cervical cancer, esophagus cancer, thyroid cancer and bladder cancer with 570,000. The incidence of cancer globally is on the rise.

Treatment of Cancer

The burden of cancer is gradually increasing and the number of patients is increasing, but with the development of cancer treatment, the survival of cancer patients is also gradually improving. Peptides have the characteristics of small molecular weight, strong targeting, high activity, weak toxicity, and easy absorption through membranes. Tests have shown that the anticancer mechanism of peptides is multiple. Peptides can inhibit the growth and metastasis of cancer cells, kill cancer cells, remove toxins from cancer cells, and have the effects of tumor prevention, control and adjuvant therapy. Peptide-based therapy is of great value for the clinical treatment of tumors.

Anticancer drug - BOC Sciences

  • Immune Checkpoint Inhibitors

Immune checkpoints refer to a series of molecules that are expressed on immune cells and can regulate the degree of immune activation. They play an important role in preventing the onset of autoimmunity. The abnormal expression and function of immune checkpoint molecules is one of the important reasons for the occurrence of many diseases. If the immune checkpoint molecules are overexpressed or function too strong, the immune function is suppressed, and the immune system of the body is weakened, which can easily lead to the occurrence of diseases such as tumors. Conversely, if the immune function is too strong, it is easy to cause the occurrence of autoimmune diseases.

Cancer cells trick immune checkpoints by sending wrong commands to immune cells and successfully block immunity. Immune checkpoint inhibitors (ICIs) are drugs that prevent cancer from suppressing the immune system and allow immune cells to work properly. ICIs mainly include cytotoxic T lymphocyte-associated antigen-4 (CTLA-4) inhibitors, programmed cell death protein (PD-1) inhibitors, and programmed cell death protein ligand-1 (PD-L1) inhibitors, etc. ICIs can regulate the body's autoimmune response to exert anti-tumor effects. ICIs can be used for the treatment of various malignant tumors such as lung cancer, colorectal cancer, gastric cancer, melanoma, breast cancer, etc., and improve the survival of patients with advanced tumors.

NameCASSequencePrice
PD-1/PD-L1 Inhibitor 31629654-95-0FANPHLGWSWXXRXGInquiry
BMSpep-571629655-80-6{mercaptoacetic acid}-FANPHLSWSW-{norleucine}-{norleucine}-RCG (Sulfide bridge:mercaptoacetic acid 1-Cys15)Inquiry
Human PD-L1 inhibitor VLDYVNRRKMYQInquiry
NP-121353564-66-5H-SNTSESFKF(H-SNTSESF)RVTQLAPKAQIKE-NH2Inquiry
  • RGD Peptides

RGD peptides are a class of short peptides containing arginine-glycine-aspartic acid (Arg-Gly-Asp) that are widely present in living organisms. RGD peptides act as recognition sites for integrins and their ligands to mediate interactions between cells and the extracellular matrix and between cells. RGD peptide not only competitively binds to integrin receptors, inhibits tumor cell adhesion and metastasis, but also directly induces tumor cell apoptosis. Therefore, RGD peptides have good application prospects in the treatment of tumors.

NameCASSequencePrice
RGD peptide114681-65-1GRGDNPInquiry
GRGDSPK111119-28-9GRGDSPKInquiry
c(RGDfK)161552-03-0cyclo[Arg-Gly-Asp-D-Phe-Lys]Inquiry
Cyclo(RGDyK) Trifluoroacetate250612-42-1cyclo[Arg-Gly-Asp-D-Tyr-Lys].2TFAInquiry
GRGDS96426-21-0H-Gly-Arg-Gly-Asp-Ser-OHInquiry
GRGDSP91037-75-1Gly-Arg-Gly-Asp-Ser-ProInquiry
cyclo(RGDfC)862772-11-0cyclo[DL-Arg-Gly-DL-Asp-DL-Phe-DL-Cys]Inquiry
Cyclo(RGDyK)217099-14-4cyclo[Arg-Gly-Asp-D-Tyr-Lys]Inquiry
iRGD peptide1392278-76-0CRGDKGPDC (Disulfide bridge: Cys1-Cys9)Inquiry
RGD peptide TFAGRGDNP.TFAInquiry
GRGDSP TFAGly-Arg-Gly-Asp-Ser-Pro.TFAInquiry
RGD Trifluoroacetate120103-89-1Arg-Gly-Asp.TFAInquiry
YRGDS Fibronectin Fragment134282-68-1Tyr-Arg-Gly-Asp-SerInquiry
GRGDSPC91575-26-7GRGDSPCInquiry
H-Arg-Gly-Asp-Cys-OH109292-46-8Arg-Gly-Asp-CysInquiry
Arg-Gly-Asp-Ser91037-65-9H-Arg-Gly-Asp-Ser-OHInquiry
Arg-Gly-Asp TFA salt2378808-45-6Arg-Gly-AspInquiry
Arg-Gly-Asp99896-85-2H-Arg-Gly-Asp-OHInquiry
  • Gonadotropin-Releasing Hormone (GnRH) Analogs

Gonadotropin-releasing hormone (GnRH) is a neurohormone secreted by the hypothalamus with considerable activity potential. Gonadotropin-releasing hormone analogs can directly act on tumor tissue, inhibit tumor cell proliferation, and cause cell apoptosis. Studies have shown that gonadotropin-releasing hormone analogs can be used to preserve the reproductive function of patients with early-stage endometrial cancer and protect the ovarian function of patients undergoing tumor chemotherapy, and can also be used for the treatment of advanced and recurrent ovarian and prostate cancers.

NameCASSequencePrice
GnRH-IPyr-HWSYGLRPG-NH2Inquiry
Fertirelin38234-21-8Glp-HWSYGLRPInquiry
Gonadorelin diacetate71447-49-9XHWSYGLRPGInquiry
Buserelin Acetate57982-77-1XHWSYXLRPInquiry
Abarelix183552-38-7XXXSYNLXPAInquiry
Antide112568-12-4XXXSXXLXPA (Modifications: X-1 = D-2Nal, X-2 = D-Phe{4-Cl}, X-3 = D-3Pal, X-5 = Lys{nicotinoyl}, X-6 = D-Lys{nicotinoyl}, X-8 = Lys{iPr})Inquiry
Lecirelin61012-19-9XHWSYXLRPInquiry
Leuprolide Acetate74381-53-6XHWSYLLRPInquiry
Cetrorelix diacetate130143-01-0D-2Nal-F(4-Cl){D-3Pal}SY{D-Cit}LRPAInquiry
Degarelix acetate hydrate934246-14-7Ac-D-2Nal-D-Phe(4-Cl)-D-3Pal-Ser-Phe(4-S-dihydroorotamido)-D-Phe(4-ureido)-Leu-Lys(iPr)-Pro-D-Ala-NH2.CH3CO2H.H2OInquiry
Histrelin76712-82-8XHWSYXLRP (Modifications: X-1 = Pyr, X-6 = D-His{1-Bn})Inquiry
Gonadorelin Acetate34973-08-5XHWSYGLRPGInquiry
Triptorelin Acetate140194-24-7XHWSYWLRPG.CH3CO2H(Modifications: X-1 = Pyr)Inquiry
Triptorelin Pamoate124508-66-3XHWSYWLRPGInquiry
Deslorelin acetate82318-06-7XHWSYWLRPInquiry
Nafarelin Acetate78115-72-7XHWSYXLRPGInquiry
Nafarelin76932-56-4XHWSYXLRPGInquiry
Degarelix214766-78-6Ac-D-2Nal-D-Phe(4-Cl)-D-3Pal-Ser-Phe(4-S-dihydroorotamido)-D-Phe(4-ureido)-Leu-Lys(iPr)-Pro-D-Ala-NH2Inquiry
Gonadorelin33515-09-2XHWSYGLRPGInquiry
Deslorelin57773-65-6XHWSYWLRPInquiry
sGnRH-A96497-82-4XHWSYRWLP-NHEt (Modifications: X-1 = Pyr)Inquiry
LGnRH-III, lamprey147859-97-0pGLP-HWSHDWKPG-NH2Inquiry
Cetrorelix Acetate145672-81-7XX(4-Cl)XSYXLRPAInquiry
Alarelin148029-26-9XHWSYALRPInquiry
Ganirelix Acetate129311-55-3XXXSYXLXPAInquiry
Luteinizing Hormone-Releasing Hormone (LH-RH)86073-88-3XHWSYGWLPGInquiry
LHRH (chicken)47922-48-5pGLU-HWSYGLQPGInquiry
  • Matrix Metalloproteinase (MMP) Inhibitors & Substrates

Matrix metalloproteinases (MMPs) are a highly conserved class of enzymes composed of a family of zinc ion-dependent proteolytic enzymes. MMPs have the same basic structure, and they all contain three domains: signal peptide, leader peptide and enzyme catalytic domain. MMPs play important roles in tumor cell apoptosis, metastasis, and angiogenesis. Studies have shown that proper inhibition and regulation of MMPs can control tumor cell invasion and metastasis, block tumor angiogenesis, and thereby block tumor growth and development. Matrix metalloproteinase inhibitors are a family of multifunctional cytokines that specifically inhibit the activity of matrix metalloproteinases. MMP inhibitors can reduce primary tumor growth, while reducing the number and size of metastatic tumors.

NameCASSequencePrice
H-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH (Disulfide bond)244082-19-7CTTHWGFTLC (Disulfide Bridge: Cys1-Cys10)Inquiry
Histatin 5104339-66-4DSHAKRHHGYKRKFHEKHHSHRGYInquiry
Dnp-PLGMWSR135662-07-6PLGMWSRInquiry
Matrilysin (96-107)SLFPNSPKWTSKInquiry
  • Growth Factor (GF) Analogs

Growth factor (GF) generally refers to a class of cytokines that can stimulate cell proliferation, differentiation and growth, including transforming growth factor (TGF), vascular endothelial growth factor (VEGF), fibroblast growth factor (FGF), Epidermal growth factor (EGF) etc. Among them, growth factors acting on epithelial, endothelial and mesenchymal cells are involved in the formation of solid tumors. Growth factors acting on hematopoiesis and lymphocytes are involved in the formation of malignant tumors of the blood and lymphatic systems. High levels of GF expression are found in many primary tumor specimens. Therefore, the study of GF has greatly promoted the development of tumor therapeutics.

NameCASSequencePrice
EGF Receptor Substrate 2 Phospho-Tyr5HDADE-pTyr-LIPQQG-OHInquiry
EGFRvIII peptide (PEPvIII)129112-17-0LEEKKGNYVVTDHCInquiry
[pTyr5] EGFR 988-993159453-08-4Asp-Ala-Asp-Glu-pTyr-LeuInquiry
EGF-R (1138-1147)YLNTVQPTCVInquiry
TGF-beta receptor type-2 (131-139)RLSSCVPVAInquiry
VEGFR2/KDR fragment 1 (614-624)FSNSTNDILIInquiry
K-FGFAAVALLPAVLLALLAPInquiry
α-epidermal growth factor, human62253-63-8NSDSECPLSHDGYCLHDGVCMYIEALDKYA
CNCVVGYIGERCQYRDLKWWELR
Inquiry
  • Melanoma Peptide

Melanoma is a highly malignant tumor originating from melanocytes, mainly in the skin. Melanoma is the deadliest form of skin cancer. Melanoma has the characteristics of early metastasis, rapid progression, poor prognosis and high mortality. Currently, the only effective treatment for melanoma is early diagnosis and surgical removal of the tumor and potentially surrounding healthy skin. Certain peptides have been shown to be effective in fighting cancer progression, killing melanoma cells and slowing the growth of malignant melanoma.

NameCASSequencePrice
MART-1 (26-35) human156251-01-3EAAGIGILTVInquiry
Gp100 (25-33) (human)212370-40-6KVPRNQDWLInquiry
Gp100 619-627187987-68-4RLMKQDFSVInquiry
MAGE-A3 (195-203)171066-85-6IMPKAGLLIInquiry
MAGE-1 (102-112)ITKKVADLVGFInquiry
MAGE-12 (114-127)AELVHFLLLKYRARInquiry
MAGE-12 (127-141)REPFTKAEMLGSVIRInquiry
MAGE-12 (170-178)VRIGHLYILInquiry
MAGE-1 (222-231)EVYDGREHSAInquiry
MAGE-1 (230-238)SAYGEPRKLInquiry
MAGE-1 (268-282)PRALAETSYVKVLEYInquiry
MAGE-1 (278-286)KVLEYVIKVInquiry
MAGE-1 (281-292)EYVIKVSARVRFInquiry
MAGE-1 (289-298)RVRFFFPSLInquiry
MAGE-1 (62-70)SAFPTTINFInquiry
MAGE-1 (90-104)TSCILESLFRAVITKInquiry
MAGE-1 (96-104)SLFRAVITKInquiry
MAGE-2 (127-136)REPVTKAEMLInquiry
MAGE-2 (156-164)EYLQLVFGIInquiry
MAGE-2 (157-166)YLQLVFGIEVInquiry
MAGE-2 (212-220)EGDCAPEEKInquiry
MAGE-3 (111-125)RKVAELVHFLLLKYRInquiry
MAGE-3 (111-126)RKVAELVHFLLLKYRAInquiry
MAGE-3 (112-120)KVAELVHFLInquiry
MAGE-3 (113-121)VAELVHFLLInquiry
MAGE-3 (114-122)AELVHFLLLInquiry
MAGE-3 (119-134)FLLLKYRAREPVTKAEInquiry
MAGE-3 (143-151)WQYFFPVIFInquiry
MAGE-3 (149-160)VIFSKASSSLQLInquiry
MAGE-3 (161-175)VFGIELMEVDPIGHLInquiry
MAGE-3 (167-176)MEVDPIGHLYInquiry
MAGE-3 (168-176)EVDPIGHLYInquiry
MAGE-3 (191-205)GDNQIMPKAGLLIIVInquiry
MAGE-3 (243-258)KKLLTQHFVQENYLEYInquiry
MAGE-3 (267-282)ACYEFLWGPRALVETSInquiry
MAGE-3 (281-295)TSYVKVLHHMVKISGInquiry
MAGE-3 (97-105)TFPDLESEFInquiry
MAGE-4 (143-151)NYKRCFPVIInquiry
MAGE-4 (156-163)SESLKMIFInquiry
MAGE-4 (169-177)EVDPASNTYInquiry
MAGE-4 (230-239)GVYDGREHTVInquiry
MAGE-6 (121-134)LLKYRAREPVTKAEInquiry
MAGE-6 (168-176)EVDPIGHVYInquiry
MAGE-6 (290-298)MVKISGGPRInquiry
MAGE-6 (293-301)ISGGPRISYInquiry
MART-1 (100-111)APPAYEKLpSAEQfInquiry
MART-1 (100-114)APPAYEKLSAEQSPPInquiry
MART-1 (100-116)APPAYEKLSAEQSPPPYInquiry
MART-1 (1-20)MPREDAHFIYGYPKKGHGHSInquiry
MART-1 (24-33(34))AEEAAGIGIL(T)Inquiry
MART-1 (32-40)ILTVILGVLInquiry
MART-1 (51-61)RNGYRALMDKSInquiry
MART-1 (51-73)RNGYRALMDKSLHVGTQCALTRRInquiry
MART-1 (91-110)KNCEPVVPNAPPAYEKLSAEInquiry
MART-1 (97-116)VPNAPPAYEKLSAEQSPPPYInquiry
MART 1 peptide (1-10)ELAGIGILTVInquiry
Melanocyte protein Pmel 17 precursor (40-57)RTKAWNRQLYPEWTEAQRInquiry
Melanocyte protein Pmel 17 precursor (44-57)WNRQLYPEWTEAQRInquiry
Melanocyte protein Pmel 17 precursor (45-57)NRQLYPEWTEAQRInquiry
Melanocyte protein Pmel 17 precursor (46-57)RQLYPEWTEAQRInquiry
Melanoma antigen gp100 (280-288)YLEPGPVTAInquiry
Melanoma antigen preferentially expressed in tumors (100-108)VLDGLDVLLInquiry
Melanoma antigen preferentially expressed in tumors (142-151)SLYSFPEPEAInquiry
Melanoma antigen preferentially expressed in tumors (300-309)ALYVDSLFFLInquiry
Melanoma antigen preferentially expressed in tumors (301-309)LYVDSLFFLInquiry
Melanoma antigen preferentially expressed in tumors (425-433)SLLQHLIGLInquiry
Melanoma-associated antigen C1 (1083-1091)KVVEFLAMLInquiry
Melanoma-associated antigen C1 (137-149)SSALLSIFQSSPEInquiry
Melanoma-associated antigen C1 (450-458)SFSYTLLSLInquiry
Melanoma-associated antigen C1 (779-787)VSSFFSYTLInquiry
Melanoma-associated antigen C1 (959-968)ILFGISLREVInquiry
Melanoma-associated antigen C2 (191-200)LLFGLALIEVInquiry
Melanoma-associated antigen C2 (307-315)SESIKKKVLInquiry
Melanoma-associated antigen C2 (336-344)ALKDVEERVInquiry
Melanoma-associated antigen C2 (42-50)ASSTLYLVFInquiry
Melanoma-associated antigen C2 (43-57)SSTLYLVFSPSSFSTInquiry
melanoma-overexpressed antigen 1 (11-23)TSREQFLPSEGAAInquiry
melanoma-overexpressed antigen 1 (24-37)CPPWHPSERISSTLInquiry
melanoma-overexpressed antigen 1 (31-44)ERISSTLNDECWPAInquiry
melanoma-overexpressed antigen 1 (36-44)TLNDECWPAInquiry
MAGE-1 Antigen (161-169) (human)144449-86-5EADPTGHSYInquiry
MAGE-3 Antigen (271-279) (human)160295-81-8FLWGPRALVInquiry
MART-1 (27-35) (human)156251-11-5AAGIGILTVInquiry
Melanocyte protein Pmel 17 precursor (44-59)195523-86-5WNRQLYPEWXEAQRLDInquiry
Disomotide181477-43-0IMDQVPFSVInquiry
  • Somatostatin & Analogs

Somatostatin is a cyclic polypeptide hormone composed of 14 amino acids. Somatostatin has a wide range of physiological activities and inhibits almost all physiological endocrine responses of the body. Studies have shown that somatostatin and its analogs can inhibit a variety of tumor cells, with strong selectivity, few adverse reactions, and good tolerance. Somatostatin and its analogs exert anti-cancer effects by inhibiting tumor cell proliferation, inducing apoptosis, inhibiting cytokine synthesis and secretion, inhibiting tumor angiogenesis, inhibiting tumor cell adhesion and invasion, and improving tumor sensitivity to chemotherapeutic drugs. tumor effect.

NameCASSequencePrice
Somatostatin51110-01-1AGCKNFFWKXFXSCInquiry
Somatostatin 1-2874315-46-1SANSNPAMAPRERKAGC(1)KNFFWKTFTSC(1)Inquiry
Somatostatin (Sheep)38916-34-6HAGCKNFFWKTFTSC-OH (Disulfide bridge: Cys3-Cys14)Inquiry
Somatostatin-28 1-1281286-16-0SANSNPAMAPREInquiry
Somatostatin-2576461-17-1SNPAMAPRERKAGCKNFFWKXFXSCInquiry
Somatostatin-28 (1-14)79243-10-0SANSNPAMAPRERKInquiry
Tyr-Somatostatin-1458100-03-1YAGCKNFFWKXFXSCInquiry
RC 160103222-11-3FCYWKVCW
(Modifications: Phe-1 = D-Phe, Trp-4 = D-Trp, Trp-8 = C-terminal amide, Disulfide bridge between 2-7)
Inquiry
CYN 154806183658-72-2X(4-NO2)C(1)YWKTC(1)YInquiry
TT-232147159-51-1FCYWKCTInquiry
Pasireotide396091-73-9cyclo[Hyp(Unk)-Phg-D-Trp-Lys-Tyr(Bn)-Phe]Inquiry
Pasireotide Diaspartate820232-50-6H-Asp-OH.H-Asp-OH.cyclo[Hyp(Unk)-Phg-D-Trp-Lys-Tyr(Bn)-Phe]Inquiry
Pasireotide L-aspartate salt396091-77-3H-Asp-OH.cyclo[DL-Lys-DL-Tyr(Bn)-DL-Phe-DL-xiHyp(Unk)-DL-Phg-DL-Trp]Inquiry
CYN 154806 TFAAc-FCYWKTCY-NH2.TFA (Disulfide bridge: Cys2-Cys7)Inquiry
J-2156848647-56-3Unk-Dab-Phe-NH2Inquiry
  • Peptide Fragment of Tyrosinase

The essence of most enzymes is a protein, a polypeptide, a combination of single peptides, and a product of stacking amino acid molecules. Tyrosinase is no exception. Tyrosinase plays an important role in regulating cell proliferation and differentiation. Excessive activation of certain tyrosinase enzymes can cause overexpression or hyperproliferation of cells, turning normal cells into tumor cells. At present, anti-tumor research targeting tyrosinase is developing rapidly. Most molecularly targeted antitumor drugs are protein tyrosine kinase inhibitors.

  • Other Related Products
NameCASSequencePrice
Epithalone307297-39-8Ala-Glu-Asp-GlyInquiry
Golotimod229305-39-9H-D-gGlu-Trp-OHInquiry
Super-TDU 1-31SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTInquiry
PACAP (6-38), human, ovine, rat143748-18-9FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2Inquiry
ObtustatinCTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG (Disulfide bridge: Cys1 and Cys10, Cys6 and Cys29, Cys7 and Cys34, Cys19 and Cys36)Inquiry
PACAP (6-38), human, ovine, rat TFAFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2.TFAInquiry
Antiviral protein Y3VYINKLTPPCGTMYYACEAVInquiry
MelectinGFLSILKKVLPKVMAHMKInquiry
LTX-3151345407-05-7KKWWKKW-Dip-K-NH2Inquiry
RC-3095138147-78-1D-Tpi-Gln-Trp-Ala-Val-Gly-His-Leu-Y(CH2-NH)-Leu-NH2Inquiry
Antagonist G115150-59-9H-Arg-D-Trp-N(Me)Phe-D-Trp-Leu-Met-NH2Inquiry
G3-C12 TFAANTPCGPYTHDCPVKR.TFAInquiry
Inquiry Basket