Thymosin β15
Need Assistance?
  • US & Canada:
    +
  • UK: +

Thymosin β15

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Thymosin is a small protein found in many animal tissues. Thymosin β15 is a polypeptide modulator of actin dynamics.

Category
Peptide Inhibitors
Catalog number
BAT-009052
Molecular Formula
C225H377N59O80S3
Molecular Weight
5285.05
Synonyms
Thymosin β15; Tβ15; Tb15; NB thymosin; NB thymosin beta; thymosin NB; TMSB15A; thymosin-like protein 8; TMSL8; TMSNB; thymosin beta-15A; thymosin beta 15A
Sequence
MCDLPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEEKECVKSS
Storage
Store at -20°C
1. C-terminal variations in beta-thymosin family members specify functional differences in actin-binding properties
J S Eadie, S W Kim, P G Allen, L M Hutchinson, J D Kantor, B R Zetter J Cell Biochem. 2000 Mar;77(2):277-87. doi: 10.1002/(sici)1097-4644(20000501)77:23.0.co;2-q.
Mammalian cells express several isoforms of beta-thymosin, a major actin monomer sequestering factor, including thymosins beta4, beta10, and beta15. Differences in actin-binding properties of different beta-thymosin family members have not been investigated. We find that thymosin beta15 binds actin with a 2.4-fold higher affinity than does thymosin beta4. Mutational analysis was performed to determine the amino acid differences in thymosin beta15 that specify its increased actin-affinity. Previous work with thymosin beta4 identified an alpha-helical domain, as well as a conserved central motif, as crucial for actin binding. Mutational analysis confirms that these domains are also vital for actin binding in thymosin beta15, but that differences in these domains are not responsible for the variation in actin-binding properties between thymosins beta4 and beta15. Truncation of the unique C-terminal residues in thymosin beta15 inhibits actin binding, suggesting that this domain also has an important role in mediating actin-binding affinity. Replacement of the 10 C-terminal amino acids of thymosin beta15 with those of thymosin beta4 did, however, reduce the actin-binding affinity of the hybrid relative to thymosin beta15. Similarly, replacement of the thymosin beta4 C-terminal amino acids with those of thymosin beta15 led to increased actin binding. We conclude that functional differences between closely related beta-thymosin family members are, in part, specified by the C-terminal variability between these isoforms. Such differences may have consequences for situations where beta-thymosins are differentially expressed as in embryonic development and in cancer.
2. Thymosin beta-NB is the human isoform of rat thymosin beta15
Jacqueline Banyard, Lloyd M Hutchinson, Bruce R Zetter Ann N Y Acad Sci. 2007 Sep;1112:286-96. doi: 10.1196/annals.1415.024. Epub 2007 Jun 13.
Thymosin beta15 is a small actin-binding protein upregulated in highly metastatic rat prostate cancer cells, relative to low metastatic cells. We have previously established an important role for thymosin beta15 as a diagnostic marker in human prostate cancer, with potential as a prognostic indicator. We here review the data supporting increased thymosin beta15 expression in other cancer types, including breast, brain, and lung. Human NB thymosin beta is a beta-thymosin originally found in neuroblastoma. New data demonstrate that NB thymosin beta represents the human homolog of rat thymosin beta15; thus we suggest classification as human thymosin beta15. In addition to the previously described gene, thymosin beta15a, we report the discovery of a new isoform of human thymosin beta15, thymosin beta15b, which is transcribed from an independent gene on human chromosome X. The gene structure of thymosin beta15a and beta15b is conserved and the isoforms show 87% identity across the nucleotide sequence. Across the coding sequence the nucleotide differences are silent, resulting in identical proteins. Other thymosin family members have recently been shown to exert potent clinical effects. The functional data available for thymosin beta15, combined with the tumor expression pattern, suggest that thymosin beta15 may play an important role in tumor development and progression in addition to its value as a biomarker in prostate cancer.
3. A thymosin beta15-like peptide promotes intersegmental myotome extension in the chicken embryo
Verena Chankiewitz, Gabriela Morosan-Puopolo, Faisal Yusuf, Stefan Rudloff, Felicitas Pröls, Veronika Kleff, Dietrich Kurt Hofmann, Beate Brand-Saberi Histochem Cell Biol. 2014 Mar;141(3):275-87. doi: 10.1007/s00418-013-1156-z. Epub 2013 Oct 23.
Beta-thymosins constitute a group of small actin-sequestering peptides. These highly conserved peptides are involved in cytoskeleton dynamics and can influence different cell properties such as motility, substrate adhesion, shape and chemotaxis. As a marker for tumour metastasis, the mammalian thymosin beta15 is believed to have an important diagnostic relevance in cancer prognosis, although little is known about its physiological function. In order to study the role of thymosin beta15(avian) in embryogenesis, we cloned the chicken and quail orthologues of thymosin beta15 and used the chicken as a model for vertebrate development. Avian thymosin beta15, the first known non-mammalian thymosin beta15-like gene, encodes a peptide that possesses a cysteine at position one after the methionine which is a significant difference compared to its mammalian counterparts. Thymosin beta15(avian) expression starts at an early stage of development. The expression pattern changes rapidly with development and differs from that of the related thymosin beta4 gene. The most prominent expression domain is seen in developing muscles of limbs and trunk. Gain-of-function experiments revealed that thymosin beta15(avian) has a function in normal myotome development. Ectopic over-expression of thymosin beta15(avian) leads to premature elongation of myotome cells trespassing segment borders. We conclude that thymosin beta15(avian) has a still undescribed function in promoting myocyte elongation.
Online Inquiry
Inquiry Basket